PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g22907.1.p
Common NameBRADI_1g22907, LOC100828968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 486aa    MW: 52102.2 Da    PI: 6.3388
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g22907.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2861.1e-87724822373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl..fsevsPi 90 
                       ++lL++cA a++++d++l+q++L+ l+++a  dgd++qRl+a f+ AL +r +r  ++ +ka+++  ++      +++++a++l  f++++P+
  Bradi1g22907.1.p  72 EQLLVHCASAIEANDATLTQQILWVLNNIAPADGDSTQRLTAAFLCALVSRASR--TGACKAVTAAVAAAVAveDVHRFTAVELagFVDLTPW 162
                       79****************************************************..666666655544444422444555555589******* PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...........skeeleetgerLakfAeel 172
                       ++f++++aN aIlea+eg   vH++D++ ++++Q p+L++ LasR+egpp lR+T+ + ++++             +++ee+g +L +fA++ 
  Bradi1g22907.1.p 163 HRFGYMAANAAILEAAEGFPVVHVVDLSTTHCMQIPTLIDLLASRAEGPPILRLTVADVSSNSssssssspppvLDTSYEELGAKLVSFARSR 255
                       *******************************************************98876666779999998887899*************** PP

              GRAS 173 gvpfefnvl.......vakrledleleeLrvkp....gEalaVnlvlqlhrll...................desvsleserdevLklvksls 235
                       +v+++f+v+        a+ l++l++++L v+      Eal++n+++ lh ++                   +++vsl   r+ +Lk ++sl 
  Bradi1g22907.1.p 256 NVSMDFRVVrtspadaFASLLDTLRMQQLLVSDssscSEALVINCHMLLHAVPdetagsvmstltagllpqqQQPVSL---RTMLLKSLRSLD 345
                       *********999988878889999*****98888999********************************744444444...66********** PP

              GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                       P +vv++e++ad ++ + + r+  a+++ +  +d++++ lp++   +r+++E+e +g++++nv+a+eg +r+er+e  ++W +r++ aGF++v
  Bradi1g22907.1.p 346 PALVVIAEEDADFTACDVVGRLRAAFNFLWIPYDAVDTFLPKQGsAQRRWYEAE-VGWKVENVLAQEGVARVERQEGRARWGQRMRGAGFRAV 437
                       *****************************************986599999**99.************************************** PP

              GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        ++e+aa +++++l++++  g+ ++ e++ l+l+Wk++++v++SaW
  Bradi1g22907.1.p 438 GIGEEAAGEVRTMLNEHA-AGWGMKREDDDLLLTWKGHNVVFASAW 482
                       ******************.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.42745464IPR005202Transcription factor GRAS
PfamPF035143.7E-8572482IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MMQFTHAAVT APPLHHHHHH HGHHVPNNAA HGLGLGLLLD VGTPRPWPGT TTPTTASSKI  60
SLGNLNSAGC MEQLLVHCAS AIEANDATLT QQILWVLNNI APADGDSTQR LTAAFLCALV  120
SRASRTGACK AVTAAVAAAV AVEDVHRFTA VELAGFVDLT PWHRFGYMAA NAAILEAAEG  180
FPVVHVVDLS TTHCMQIPTL IDLLASRAEG PPILRLTVAD VSSNSSSSSS SSPPPVLDTS  240
YEELGAKLVS FARSRNVSMD FRVVRTSPAD AFASLLDTLR MQQLLVSDSS SCSEALVINC  300
HMLLHAVPDE TAGSVMSTLT AGLLPQQQQP VSLRTMLLKS LRSLDPALVV IAEEDADFTA  360
CDVVGRLRAA FNFLWIPYDA VDTFLPKQGS AQRRWYEAEV GWKVENVLAQ EGVARVERQE  420
GRARWGQRMR GAGFRAVGIG EEAAGEVRTM LNEHAAGWGM KREDDDLLLT WKGHNVVFAS  480
AWAPS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236152.20.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-163SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A0Q3GWS90.0A0A0Q3GWS9_BRADI; Uncharacterized protein
STRINGBRADI1G22907.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-151GRAS family protein