PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20805.1.p
Common NameBRADI_1g20805, LOC100829651
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 317aa    MW: 35846.8 Da    PI: 6.0928
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20805.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.5e-50121411128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       l+pGfrF+Ptdee+v++yL+kkv+++++ + ++i evdi+k+ePw Lp k+k    + +ewyf+ ++d+ky+tg+r nr+t++gyWk tgkdk
  Bradi1g20805.1.p  12 LAPGFRFRPTDEEIVSFYLNKKVKDNSFCT-TAIGEVDINKWEPWVLPLKAKMsgpGVQEWYFYYQKDRKYPTGRRINRTTEAGYWKVTGKDK 103
                       579************************988.78***************53333235778********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       e+++ +g l+g+kktLvfy grap+g+kt+Wvmhey +
  Bradi1g20805.1.p 104 EIFHGHGLLIGMKKTLVFYMGRAPNGKKTNWVMHEYMI 141
                       ****9*******************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-557169IPR003441NAC domain
PROSITE profilePS5100554.21912168IPR003441NAC domain
PfamPF023652.2E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MGDLLHQQQL VLAPGFRFRP TDEEIVSFYL NKKVKDNSFC TTAIGEVDIN KWEPWVLPLK  60
AKMSGPGVQE WYFYYQKDRK YPTGRRINRT TEAGYWKVTG KDKEIFHGHG LLIGMKKTLV  120
FYMGRAPNGK KTNWVMHEYM IPSYTTNDAI NTSSNLKDEW VVCRVFHKNT KEVVMSCPME  180
QMNNDEITIS MPMSMAGDDQ QGFDTSIMAC TQTIQLPPPM DPTSSMYKMY DNAGSSSLVP  240
LATNDLYFGN NQASPMSFYQ HHMQMPTQMD AMAGEGFMVA PTSGPSSMVL QDHNTNTADE  300
TFLVDQMGRD GMGNNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-47917014167NO APICAL MERISTEM PROTEIN
1ut4_B2e-47917014167NO APICAL MERISTEM PROTEIN
1ut7_A2e-47917014167NO APICAL MERISTEM PROTEIN
1ut7_B2e-47917014167NO APICAL MERISTEM PROTEIN
3swm_A2e-47917017170NAC domain-containing protein 19
3swm_B2e-47917017170NAC domain-containing protein 19
3swm_C2e-47917017170NAC domain-containing protein 19
3swm_D2e-47917017170NAC domain-containing protein 19
3swp_A2e-47917017170NAC domain-containing protein 19
3swp_B2e-47917017170NAC domain-containing protein 19
3swp_C2e-47917017170NAC domain-containing protein 19
3swp_D2e-47917017170NAC domain-containing protein 19
4dul_A2e-47917014167NAC domain-containing protein 19
4dul_B2e-47917014167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g20805.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559932.10.0NAC domain-containing protein 87
SwissprotQ9FK449e-66NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A0Q3RQ420.0A0A0Q3RQ42_BRADI; Uncharacterized protein
STRINGTraes_7AL_38B48B7B2.21e-84(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-68Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]