PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20063.2.p
Common NameBRADI_1g20063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 379aa    MW: 42387.7 Da    PI: 4.8005
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20063.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.54e-301002293128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknra......tksgyWkatgk 88 
                       pG+rFhPtd el+  yL++k  g+++++ +++k++++++++P++ ++ + ++ + +wy F++r++ky+ g+r+ r+       k gyWk+  k
  Bradi1g20063.2.p 100 PGVRFHPTDTELI-GYLRRKYGGRRMPA-DIVKDFNVFQHHPSTVQEiCGDSIDGSWYVFTPRNRKYEDGSRPDRSvicegnNKIGYWKSNVK 190
                       9************.9*************.99**************95244445669*******************6577777679******** PP

               NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++++ +g+++g  + L+f  g++pkge t+W m+eyr+
  Bradi1g20063.2.p 191 ETDITV-GGKVIGKTNALTFALGNQPKGELTRWRMKEYRI 229
                       ******.9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100535.09898266IPR003441NAC domain
SuperFamilySSF1019411.26E-3599266IPR003441NAC domain
PfamPF023653.7E-16100229IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGRRRGRPRG STKPMLANKA AAKPKPKHAK SARQIPAAPT PEPDQEQPTT EQPVASATTP  60
TVAGEEEEEA EEAVGTSSEG AEQEKGEDEE EVEYAATDLP GVRFHPTDTE LIGYLRRKYG  120
GRRMPADIVK DFNVFQHHPS TVQEICGDSI DGSWYVFTPR NRKYEDGSRP DRSVICEGNN  180
KIGYWKSNVK ETDITVGGKV IGKTNALTFA LGNQPKGELT RWRMKEYRIP DNRRKRDPKR  240
RKPSQRILDP DDMLLDEWVI CKLFYNKNKK DQDGAPVDVG GQQDGEVNED ADEEADGKDD  300
DTDDGNPPSD GHEDADEEAD GKDDDTNDGI HHQMDMKTPM KKPVAKTTTQ TMGIHHQMNM  360
KILYMVPFST NDFAFEDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-2710027217174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g20063.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229598.30.0NAC domain-containing protein 67
TrEMBLA0A2K2DK630.0A0A2K2DK63_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Representative plantOGRP1390234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.12e-25NAC family protein