PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g17480.1.p
Common NameBRADI_1g17480, LOC100826391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 376aa    MW: 40073.9 Da    PI: 6.6435
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g17480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-5281361128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+ +yL++++++ ++++  +i++vdiyk++PwdLp ++  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++
  Bradi1g17480.1.p   8 LPPGFRFHPTDEELILHYLRNRAASAPCPV-PIIADVDIYKFDPWDLPCQAVYGEQEWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIH 99 
                       79****************************.88***************65556799************************************* PP

               NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +   +ge vg+kk Lvfykgr pkg+kt+W+mheyrl
  Bradi1g17480.1.p 100 DPatGGEPVGVKKALVFYKGRPPKGSKTSWIMHEYRL 136
                       99889999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-634178IPR003441NAC domain
PROSITE profilePS5100560.2338178IPR003441NAC domain
PfamPF023653.5E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MSTTAAALPP GFRFHPTDEE LILHYLRNRA ASAPCPVPII ADVDIYKFDP WDLPCQAVYG  60
EQEWYFFSPR DRKYPNGIRP NRAAGSGYWK ATGTDKPIHD PATGGEPVGV KKALVFYKGR  120
PPKGSKTSWI MHEYRLSGAD PLSSSANTNG AGNAYKPIKF RNVSMRLDDW VLCRIYKKSG  180
LQASPMVPPL ADYDHMDHTH SSGNNNNDDD GLSSFSGSGG GAGGGFVVDA DAACSSFLYA  240
PSGNTTCRTI MAPRLPAIPS MSELFDDYAL AQLFDATAAA PEEHHPAVHP SLNQLLSVGD  300
GPHAEYYSSS PSPAVTAGKR KAEDQRAPAA KRLVNGMSCF AVDDVAPQSA AAAESGLQAA  360
VLGAGLSSHQ MLPQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-69417913166NO APICAL MERISTEM PROTEIN
1ut4_B2e-69417913166NO APICAL MERISTEM PROTEIN
1ut7_A2e-69417913166NO APICAL MERISTEM PROTEIN
1ut7_B2e-69417913166NO APICAL MERISTEM PROTEIN
3swm_A2e-69417916169NAC domain-containing protein 19
3swm_B2e-69417916169NAC domain-containing protein 19
3swm_C2e-69417916169NAC domain-containing protein 19
3swm_D2e-69417916169NAC domain-containing protein 19
3swp_A2e-69417916169NAC domain-containing protein 19
3swp_B2e-69417916169NAC domain-containing protein 19
3swp_C2e-69417916169NAC domain-containing protein 19
3swp_D2e-69417916169NAC domain-containing protein 19
4dul_A2e-69417913166NAC domain-containing protein 19
4dul_B2e-69417913166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9713991e-110EU971399.1 Zea mays clone 363807 NAC domain transcription factor mRNA, complete cds.
GenBankBT0679141e-110BT067914.2 Zea mays full-length cDNA clone ZM_BFc0188L19 mRNA, complete cds.
GenBankKP2979321e-110KP297932.1 Zea mays Zma1158 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559782.10.0PREDICTED: NAC domain-containing protein 18-like
TrEMBLI1GR230.0I1GR23_BRADI; Uncharacterized protein
STRINGBRADI1G17480.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.14e-83NAC-like, activated by AP3/PI