PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g17440.1.p
Common NameBRADI_1g17440, LOC100825768
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 303aa    MW: 33451.9 Da    PI: 5.2444
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g17440.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52281571128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdee+v++yL++k+ + ++ +  vi++v+++++ePw+Lp k+k +ekew+fF+++d+ky+tg+r+nratksgyWkatg+d+e++
  Bradi1g17440.1.p  28 LPPGFRFHPTDEEVVTHYLTPKALDGRFAC-VVIADVNLNRCEPWELPGKAKMGEKEWFFFVHKDRKYPTGSRTNRATKSGYWKATGRDREIF 119
                       79*************************999.78***************99999**************************************** PP

               NAM  94 sk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +    ++ lvglkktLvfy grap+g+kt+Wvmhe+rl
  Bradi1g17440.1.p 120 RGrggSEVLVGLKKTLVFYLGRAPHGTKTQWVMHEFRL 157
                       986655566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6124181IPR003441NAC domain
PROSITE profilePS5100556.90228181IPR003441NAC domain
PfamPF023653.4E-2729157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSDVTAVMDL GEAAAPAVPR RRQQQLDLPP GFRFHPTDEE VVTHYLTPKA LDGRFACVVI  60
ADVNLNRCEP WELPGKAKMG EKEWFFFVHK DRKYPTGSRT NRATKSGYWK ATGRDREIFR  120
GRGGSEVLVG LKKTLVFYLG RAPHGTKTQW VMHEFRLDGQ LPANLPPSAK DEWAVCRVFS  180
KDMAAAAAAK AEPPQMEAAP AAPAMAMERS DSITDFLDGF LLDQLPPLMD LPLATGPMED  240
DGASFEVKAE QQENPSYFSL PATSTRVGGQ AADSMASSSK LYLGLDDLDP LMDYSNNDFW  300
KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-532518517172NAC domain-containing protein 19
3swm_B7e-532518517172NAC domain-containing protein 19
3swm_C7e-532518517172NAC domain-containing protein 19
3swm_D7e-532518517172NAC domain-containing protein 19
3swp_A7e-532518517172NAC domain-containing protein 19
3swp_B7e-532518517172NAC domain-containing protein 19
3swp_C7e-532518517172NAC domain-containing protein 19
3swp_D7e-532518517172NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559780.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLR37e-78NAC79_ARATH; NAC domain-containing protein 79
TrEMBLI1GR190.0I1GR19_BRADI; Uncharacterized protein
STRINGBRADI1G17440.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.28e-78Arabidopsis NAC domain containing protein 87