PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g17410.1.p
Common NameBRADI_1g17410, LOC100824853
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 444aa    MW: 47670.5 Da    PI: 8.0819
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g17410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3966126262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+ss
  Bradi1g17410.1.p  66 PDKILPCPRCKSMDTKFCYYNNYNVHQPRHFCKGCQRYWTAGGSMRNIPVGAGRRKSKSSS 126
                       7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2752118IPR003851Zinc finger, Dof-type
PfamPF027017.5E-3268124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.29570124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MRITKENPST QQEFDLGQIN KSSLNNSTEC ENQAPNGDER TEQGSKSEAA KTEDDGSSRD  60
KVLKKPDKIL PCPRCKSMDT KFCYYNNYNV HQPRHFCKGC QRYWTAGGSM RNIPVGAGRR  120
KSKSSSSNCR SILTPGSSLA APVGDASLIP FSVKGNEPVV TFGSDAPLCN SMASSLRVEE  180
QNKISNPAST AHPISGKNLT CPPPTTISDS QDTESVKGTV SGHQNGLAGD CNGVTPVHPI  240
PCFPGPPFMY PWNPAWNGIA AMATPICPAQ TESVKSSENG NGVNVQWNLP PMVPVPGFCG  300
PPIPFPLMPP SVWPFVSPWP NGAWSAPWLG PGYSMPAAPP TSSITCSDSA SPVLGKHPRD  360
SNLHGDEKSE KSLWIPKTLR IHDPDEAAKS SIWTTLGIEP GNRGMFRPFQ SKSGSKEQMS  420
DAARVMQANP AAQSRFQSFQ ETT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g17410.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233788.10.0cyclic dof factor 1
RefseqXP_024313586.10.0cyclic dof factor 1
TrEMBLI1GR160.0I1GR16_BRADI; Uncharacterized protein
STRINGBRADI1G17410.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.28e-72cycling DOF factor 2