PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g15482.1.p
Common NameBRADI_1g15482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 262aa    MW: 28594.4 Da    PI: 8.0312
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g15482.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.91.7e-101050242
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                       i+n s r  t  kR ng+ KK +EL +LC++e ++i+f +
  Bradi1g15482.1.p 10 LISNASTRRSTQKKRGNGLTKKLSELLTLCGVEGCLIVFPE 50
                      59************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.619153IPR002100Transcription factor, MADS-box
SMARTSM004325.8E-12161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-18293IPR002100Transcription factor, MADS-box
CDDcd002665.14E-24286No hitNo description
PRINTSPR004041.9E-6323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-111153IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MTRKKTKIEL ISNASTRRST QKKRGNGLTK KLSELLTLCG VEGCLIVFPE GDKSPPQAWP  60
SEDAARSVIE RLRAMPELDQ FRKMMDAEGF VRELIGKLQD QLRKAERDNR ERETKLLLHE  120
VIAGRRPGPG GLAGLTIEQL VSVGWMSENL INKIRDRLAC QYEQRGSFQQ LPYAGAADLD  180
QAPLQQQQQQ QGWVMEVVKA GWDLDAPPAY STGSASGSGG SYGSTVGAGA GGEVMMPQQF  240
PGFDAGFQQW ADPGTGNFPP M*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11622RRSTQKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g15482.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693500.0KF469350.1 Brachypodium distachyon MADS-box transcription factor 56 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289792.10.0uncharacterized LOC100825352
RefseqXP_024314125.10.0uncharacterized LOC100825352 isoform X1
TrEMBLA0A0Q3KTA70.0A0A0Q3KTA7_BRADI; Uncharacterized protein
STRINGBRADI1G15480.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-26AGAMOUS-like 80