PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g15420.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 391aa    MW: 40782.3 Da    PI: 8.8262
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g15420.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.6e-3988147362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+s+
  Bradi1g15420.2.p  88 QAGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 147
                       66789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-3290145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60991145IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2691144IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MIPIDLQRTP YSLYPPRLLY TPPNPLLSLT TNYLKSIHTS PLHTCTAPGI LARPMAGDEA  60
VAQQPRKGGT GTTAAQAQAP AAPGEAQQAG LRCPRCDSPN TKFCYYNNYS LSQPRHFCKT  120
CRRYWTKGGA LRNVPVGGGC RKNKRSRSSS ASSAAAASSR LSLNLPGPDH QHQQADLQQQ  180
QQHAAVRMGG GFRGVVDFHS GSMLPGPTSA VVSHGQYVPF GEWPAPGADV NNNISHGMSG  240
GGGGGSSIAS SIESLSYINQ DLHWKLQQQR VATMFLGPPI AADAQAHHHH QFGAGAAFLQ  300
METTTAVPAA ATSWFMDSSS SYAPAPLQPN SSSSPCRPPA AASCSNINSG RSTSGGGGGG  360
DVDNATSNNN NCGGSDIPSW GDISTFAMLP *
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g15420.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3123317e-63AJ312331.1 Hordeum vulgare partial dof172 gene for dof zinc finger protein, exon 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559708.20.0dof zinc finger protein DOF5.7
SwissprotQ9LSL62e-44DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A0Q3GTX50.0A0A0Q3GTX5_BRADI; Uncharacterized protein
STRINGBRADI1G15420.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-31TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Castorina G,Fox S,Tonelli C,Galbiati M,Conti L
    A novel role for STOMATAL CARPENTER 1 in stomata patterning.
    BMC Plant Biol., 2016. 16(1): p. 172
    [PMID:27484174]