PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g14570.2.p
Common NameBRADI_1g14570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 281aa    MW: 29292 Da    PI: 9.6212
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g14570.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.21.1e-3562116458
            zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                       +  +cprC s++tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+
  Bradi1g14570.2.p  62 AREQCPRCASHDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKR 116
                       5679*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-3164116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.39164118IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2265111IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MPGQVMEAPL HQLPQLTTQT AHPNYCKQDA TAASTMADMA RFLQQQQQLV QPTNQNPNAN  60
TAREQCPRCA SHDTKFCYYN NYNTSQPRHF CRACRRYWTL GGSLRNVPIG GSTRKRLRPA  120
PQQPLRHRPP VHFASPPPIP QQSAQSQQGL LGSLFALGGA PLLLEGRVGF DLGLGLPGLA  180
GQLGGLTGSG GGGAGEVGLH SLGLRGGGQS AGPGPTSSLS APLLWPSSLF ENNGGNNVET  240
WKVSGGGAAA TAMWAPAPEF SSAATVPQVG GVFHGGAQML *
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g14570.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3748303e-86AK374830.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3077I02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.20.0dof zinc finger protein DOF1.7
TrEMBLA0A0Q3NBG00.0A0A0Q3NBG0_BRADI; Uncharacterized protein
STRINGBRADI1G14570.11e-163(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.11e-25DNA binding with one finger 4.7