PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g14480.2.p
Common NameBRADI_1g14480, LOC100834660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 384aa    MW: 41166.1 Da    PI: 10.1659
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g14480.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-31100153255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi1g14480.2.p 100 PRMRWTTALHAHFVQAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 153
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-1597153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-2897153IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-24100153IPR006447Myb domain, plants
PfamPF002491.5E-7101152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MATAAAPDLS LNISPPSPAD MAGTSSGCDD MAISAETRLC LGFDMATRDN GHCDLQQQRL  60
HQPSQIPRFK KSSGDSQAGS SKERSGSGGG GGGKKSSRAP RMRWTTALHA HFVQAVQLLG  120
GHERATPKSV LELMNVKDLT LAHVKSHLQM YRTVKGTATD RSCAAGHVQM RDMGFLRTGR  180
EVDGFDVFNN ITSNTRRQPW TSPPGEQQGS AWCQPPLALS QAQAQQQRNA GLPLPSPYLM  240
SIHQYLIKQN QGWRGSAVQR DAALLPCQGQ EDRGLQGRLP AGAGHDETAR IRSSAAGFPK  300
GWSSSSSSPT STPAAQQMNG RIGSGAEQAC IRQQQQAPSR VPSLEMSLGR QGWQNGMEQQ  360
RLQGQRSVES TSASKELTLL KCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g14480.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754878.10.0uncharacterized protein LOC100834660
TrEMBLA0A0Q3NBE20.0A0A0Q3NBE2_BRADI; Uncharacterized protein
STRINGBRADI1G14480.11e-175(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Representative plantOGRP1584333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.21e-32G2-like family protein