PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g11310.2.p
Common NameBRADI_1g11310, LOC100834144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 424aa    MW: 46219.6 Da    PI: 5.9515
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g11310.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.89.3e-081356339
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                      +r C+ + + +++++C  ++ +lC+ C  + H+        H+v
  Bradi1g11310.2.p 13 ARACDGCMRRRARWHCAADDAYLCQACDASVHSAnplarrhHRV 56
                      578*****************************668888886655 PP

2CCT66.29.4e-23352395144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+a
  Bradi1g11310.2.p 352 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA 395
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.8971158IPR000315B-box-type zinc finger
SMARTSM003362.6E-61158IPR000315B-box-type zinc finger
PfamPF006437.2E-61355IPR000315B-box-type zinc finger
CDDcd000219.67E-111458No hitNo description
PROSITE profilePS5101715.993352394IPR010402CCT domain
PfamPF062031.2E-17352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MTNAGAALGA RTARACDGCM RRRARWHCAA DDAYLCQACD ASVHSANPLA RRHHRVRLSS  60
SASSSSSPAA ASQQADPDAP AWLHGLKRRP RTPRRKPGGI NGSKQQQHDA LGTKAAVAAS  120
APVPDLEAED ESLSGIIMGA GNEVDQVDED DDLLYRVPVF DPMLAELYSH TMPDDDQALE  180
QKPCFAPLLA TDPSSDQYGG VSGLADGTDG FSGFDLVPDM ELASFAADME SLLMGVDSGY  240
DDLGFLDDEK PQMNHLGFDD MQDDFDQSTV APPAPQEEEQ QEDRKRKRPD QMILKLDYEG  300
VISSWTHDGA SPWFYGERPH LDSSDSWLDF PAGSGRGFGL GAAVTAVTGG EREARVSRYR  360
EKRRTRLFAK KIRYEVRKLN AEKRPRMKGR FVKRAALPPL PPRATPMMLA APHGGSAHGR  420
YRL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18591LKRRPRT
2362378RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3732591e-107AK373259.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3025G22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559520.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6
TrEMBLI1GP670.0I1GP67_BRADI; Uncharacterized protein
STRINGBRADI1G11310.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MonocotsOGMP100042228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-50B-box type zinc finger protein with CCT domain