PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g11200.1.p
Common NameBRADI_1g11200, LOC100845859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GeBP
Protein Properties Length: 373aa    MW: 40002.6 Da    PI: 6.1803
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g11200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57383.72.6e-2678172297
            DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                       +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+K ++ ++++++g +p+  ++hd+++++l+++
  Bradi1g11200.1.p  78 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKHRNVSTRVARGLDPARLAPHDRDVLHLCSR 169
                       79*******************.556878888************************************************************** PP

            DUF573  95 iWg 97 
                       +W+
  Bradi1g11200.1.p 170 LWD 172
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.2E-2479172IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MASDQTLAAL PVLPAPSNPN QIPDPTAPLP PDLTPPASAS ASAARKLPVK RRSPPRPSSS  60
PSSSGPTAAD QDGQPPFKFQ RIWSESDELR FLQGLLGCGA QGLVFPRDLN VFYDRFSESM  120
PQPYTRSQLS EKLRRLKNKH RNVSTRVARG LDPARLAPHD RDVLHLCSRL WDPANAATSP  180
FAASAGSPGN KRRRAAPLEV PPPSGDANSH DYNGTSSATP GAFLDGNGED VMYLEQESGH  240
LYYDQGAALV ANGSLDGFTM EQTETVAALT NNGGNGVGME IAPQNFENTG VGSQNGNCTV  300
MIPRSSEHRM ASAVLDVFEE CLREAKADGM ICGGNAEESE LAKRWRAQRI DELDVLSRRL  360
RLIIEDAGAA RH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g11200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944721e-161FP094472.1 Phyllostachys edulis cDNA clone: bphylf057n04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.10.0probable transcription factor At5g28040
TrEMBLI1GP540.0I1GP54_BRADI; Uncharacterized protein
STRINGBRADI1G11200.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Representative plantOGRP9800912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-12DNA-binding storekeeper protein-related transcriptional regulator