PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g11090.1.p
Common NameBRADI_1g11090, LOC100844941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 624aa    MW: 65583.7 Da    PI: 4.8006
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g11090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.81.6e-1402406191374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPi 90 
                       lv++Ll+cAeav++++l++a+al++++  la+++g +m+++aayf eALa+r++r        ++p+++s  +  ++++a+ l   f+e +P+
  Bradi1g11090.1.p 240 LVHALLACAEAVQQENLSAAEALVKQIPLLAASQGGAMRKVAAYFGEALARRVFR--------FRPQPDS--SLLDAAFADLLhahFYESCPY 322
                       689****************************************************........5555555..34444444444456******* PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                       lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++ lva
  Bradi1g11090.1.p 323 LKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGLVA 415
                       ********************************************************************************************* PP

              GRAS 184 krledleleeLrvkp.......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                        +l+dle+ +L+ +         E++aVn+v+++hrll+++++le+    vL +v+ ++P++v+vveqea+hns+sFl+rf+e+l+yys++fd
  Bradi1g11090.1.p 416 ATLADLEPFMLQPEGeedpneePEVIAVNSVFEMHRLLSQPGALEK----VLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFD 504
                       ***********544444557789***********************....******************************************* PP

              GRAS 270 sleak.........lpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgy 349
                       sle               +    +++++++++lgr+i+nvvaceg er+erhetl++Wr rl++aGF++v+l+++a+kqa++ll+ ++ +dgy
  Bradi1g11090.1.p 505 SLEGAgsgqseispG---AaagATDQVMSEVYLGRQICNVVACEGPERTERHETLGQWRGRLGQAGFETVHLGSNAYKQASTLLALFAgGDGY 594
                       **7775666665322...1466899******************************************************************** PP

              GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                       +vee++g+l+lgW++rpL+++SaWr
  Bradi1g11090.1.p 595 KVEEKDGCLTLGWHTRPLIATSAWR 619
                       ************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.5E-3336111IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.6E-2936117No hitNo description
PROSITE profilePS5098566.435214598IPR005202Transcription factor GRAS
PfamPF035145.6E-138240619IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MKREYQDGGG SRGGGDMGSS KDKMMVAAPA EEEDMDELLA ALGYKVRASD MADVAQKLEQ  60
LEMAMGMGGV GAGAAPDDSF VAHLATDTVH SNPSDLSSWV ESMLSELNAP PPPLPPAPQA  120
PRLSSNSSTV TGGGGSGGGY FDGLPPSVDS SSSTYALRPI PSPVVTPAEP SADPAREPKR  180
MRTGGGSTSS SSSSSSSLGG GGTMSSVVEA APPAAPASAA ANAPALPVVV VDTQEAGIRL  240
VHALLACAEA VQQENLSAAE ALVKQIPLLA ASQGGAMRKV AAYFGEALAR RVFRFRPQPD  300
SSLLDAAFAD LLHAHFYESC PYLKFAHFTA NQAILEAFAG CRRVHVVDFG IKQGMQWPAL  360
LQALALRPGG PPSFRLTGVG PPQPDETDAL QQVGWKLAQF AHTIRVDFQY RGLVAATLAD  420
LEPFMLQPEG EEDPNEEPEV IAVNSVFEMH RLLSQPGALE KVLGTVRAVR PRIVTVVEQE  480
ANHNSGSFLD RFTESLHYYS TMFDSLEGAG SGQSEISPGA AAGATDQVMS EVYLGRQICN  540
VVACEGPERT ERHETLGQWR GRLGQAGFET VHLGSNAYKQ ASTLLALFAG GDGYKVEEKD  600
GCLTLGWHTR PLIATSAWRM AAP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-562406194375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9596660.0KF959666.1 Psathyrostachys huashanica DELLA protein (Rht-B1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560731.10.0PREDICTED: DELLA protein SLN1
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLI1GP390.0I1GP39_BRADI; Uncharacterized protein
STRINGBRADI1G11090.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein