PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g07630.1.p
Common NameBRADI_1g07630, LOC100829239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 350aa    MW: 37979 Da    PI: 8.4863
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g07630.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31224279156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  Bradi1g07630.1.p 224 KTRRCWSPELHRQFVAALRQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 279
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.709221281IPR017930Myb domain
SuperFamilySSF466891.58E-16222281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28222282IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-26224279IPR006447Myb domain, plants
PfamPF002498.0E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGLDVGEIGA PLDLGLDLKL FVARTAGRLA AAKEAPSMDA CIRGLEEERR KIEVFRRELP  60
LCVRLLAEVI EMMKEQAGKR SEVRDAEAKA EDNDKRKWMS TAQLWVDNRG SDSDSVVQKE  120
QKKETTLPKP MLLGGAGGAP APLMAVGFGA MPPPAPPSSQ YFSREDKVAA STEGLPALPM  180
MSPVLKRPFS PGVDDRRPAP SAKFATIMPP PALSLQSQEQ QARKTRRCWS PELHRQFVAA  240
LRQLGGPQVA TPKQIREVMK VDGLTNDEVK SHLQKYRLHN QRSSGSSSSS HSIVLVGDHW  300
PPQEQSSSQS RSPEAEGPLQ FSSSGVAVSA ATVSDSSEED DRSDGHSRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-13224282260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g07630.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229377.10.0transcription factor HHO5
TrEMBLI1GMZ10.0I1GMZ1_BRADI; Uncharacterized protein
STRINGBRADI1G07630.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.15e-44G2-like family protein