PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g07600.1.p
Common NameBRADI_1g07600, LOC100841172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 389aa    MW: 40302.5 Da    PI: 9.606
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g07600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.5e-3880137360
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Bradi1g07600.1.p  80 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 137
                       66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.9E-3282136IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2783134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09683137IPR003851Zinc finger, Dof-type
PROSITE patternPS01361085121IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MIQELLGGTP MDQHHHHQQI KSATNAMAHH HVSSLPMVLQ PISANPSPTS SSTSSRSSTQ  60
RSPSATSSPQ GQGQQQGPEQ APLRCPRCNS SNTKFCYYNN YNLTQPRHFC KTCRRYWTKG  120
GALRNVPIGG GCRKPRPMPA PVAKQSTVVP AASCKSALSG TGIGMAPPPL GLGVGPAMSS  180
WAPQQLMALL NSTRAMQGLH HGGQGHGHGG GGNNVHRLLG LDTMGQLQVL PGHSPNNAMW  240
PPVAHRPMPP PPPMHLDMAG PLGLGLGGHS DLFSNLGLKP PSSSSLAPAA SYYNDQLNAV  300
VSNGGGGAGR PNAYESPSSY SCATTMASLP AASSTVSSGL TVGMDQQQPP VSTSSSLAAQ  360
EMQYWNSGPA AMSMAAWPDL PALNGAFP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g07600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559395.10.0dof zinc finger protein DOF3.2
TrEMBLI1GMY80.0I1GMY8_BRADI; Uncharacterized protein
STRINGBRADI1G07600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-32TARGET OF MONOPTEROS 6