PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g07511.1.p
Common NameBRADI_1g07511, LOC100840568
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family G2-like
Protein Properties Length: 389aa    MW: 39803.3 Da    PI: 8.1748
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g07511.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.7e-31115168255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rF++av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Bradi1g07511.1.p 115 PRMRWTTALHARFMHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 168
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.59E-15112168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-28113168IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23115168IPR006447Myb domain, plants
PfamPF002491.4E-7116167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MLQRSLPNLS LRISPPAVSS AMTSLSDPPA TAAKPPQLAE PNAEGSGEVG FFANPSPGSG  60
SGAEPPGLSL GLGTTSSTVP ADAGGRHGHH LQGASFKRAG AARAGGSSKR SVRAPRMRWT  120
TALHARFMHA VQLLGGHERA TPKSVLELMN VKDLTLAHVK SHLQMYRTVK GTDRSPPIAT  180
GEAQLQQQQQ RTATGIEMAM DAAGGGGGGR GGGGGVAAAI LPCDIDMAAG MICSVLPGAA  240
ASAPPAATTS SAARFLCASA AAPLAALVPS PPPPPIIPPR RTDLAPGVLE KGVVIVDSLH  300
RCQKLNFSAV LQDTQAVREE VTCRLPMGVH GSIEAISTSP PSSSPSLASF ELLADDTCAP  360
NLDISLGRHD WGMEHPEEVS LKYLLQKD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16116170357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16116170357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16116170357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16116170357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207214GGRGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g07511.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3741182e-94AK374118.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3054O18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559393.10.0uncharacterized protein LOC100840568
TrEMBLA0A0Q3GPU80.0A0A0Q3GPU8_BRADI; Uncharacterized protein
STRINGBRADI1G07510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.21e-32G2-like family protein