PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g04229.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 365aa    MW: 40022.3 Da    PI: 5.0536
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g04229.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM87.81.9e-272273562128
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknra.....tksgyWkatgk 88 
                        pG+rF+Ptdee++  yL++k +g+++++ ++++++++++ +P++ ++++    +  wy Fs+rd++y++gkr+ r+      k gyWk+   
  Bradi1g04229.1.p 227 LPGVRFQPTDEEII-GYLRRKYHGRRMPA-DIVRDFNVFQDHPSTVKENFGDsIDGAWYVFSPRDRRYSRGKRPARSvykgdHKIGYWKSNTG 317
                       59************.9*************.99**************96554414459*******************646665569****8777 PP

               NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++++ +g+++g  + L+f  g++p+ge t W + eyr+
  Bradi1g04229.1.p 318 EESIIV-RGKVIGSVNNLTFALGQQPHGEPTPWKIREYRI 356
                       788888.799****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.913226365IPR003441NAC domain
SuperFamilySSF1019412.22E-29227358IPR003441NAC domain
PfamPF023651.8E-15228356IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MFRDLLLPAA AALEQPAIPQ HDASTTTEYL ESGCYDHLDD PSFFRAMTHD LQPDTQTTAF  60
LNQQLGLGAP AMAMAMQGWT DQNGYYWGQG PVHWQASASA AAAAEAPAVH AAPYLAADLP  120
DAPPPADPPN PPAGRRPRGR PRGSTAAKSR SRAKPKLATM AAEATPEPCH EQPMSTEQPA  180
GAASTALADA GEEEEAVGGT SGAQGAQQQE EEEEEEDEAV EYADTNLPGV RFQPTDEEII  240
GYLRRKYHGR RMPADIVRDF NVFQDHPSTV KENFGDSIDG AWYVFSPRDR RYSRGKRPAR  300
SVYKGDHKIG YWKSNTGEES IIVRGKVIGS VNNLTFALGQ QPHGEPTPWK IREYRIPDFQ  360
RKILL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-2022335611140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g04229.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229598.39e-68NAC domain-containing protein 67
TrEMBLA0A2K2DI190.0A0A2K2DI19_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Representative plantOGRP1390234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.11e-23Arabidopsis NAC domain containing protein 26