PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g04150.1.p
Common NameBRADI_1g04150, LOC100823743
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 326aa    MW: 35855.3 Da    PI: 7.2145
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g04150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31.1e-51181431128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtd+elv +yL++k++g +l++  +i+evd+yk++Pw Lp ++  ++kewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v 
  Bradi1g04150.1.p  18 LPPGFRFHPTDDELVEHYLCRKAAGGRLPV-PIIAEVDLYKFDPWALPDRALFGTKEWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVA 109
                       79****************************.88***************8777899*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +g++ g+kk Lvfy g+apkg+ktdW+mheyrl
  Bradi1g04150.1.p 110 P-HGRTLGIKKALVFYAGKAPKGVKTDWIMHEYRL 143
                       9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-6414172IPR003441NAC domain
PROSITE profilePS5100559.56718172IPR003441NAC domain
PfamPF023654.2E-2719143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAVRGTRRER DAEAELNLPP GFRFHPTDDE LVEHYLCRKA AGGRLPVPII AEVDLYKFDP  60
WALPDRALFG TKEWYFFTPR DRKYPNGSRP NRAAGNGYWK ATGADKPVAP HGRTLGIKKA  120
LVFYAGKAPK GVKTDWIMHE YRLADAGRAA AAGAKKGSLR LDDWVLCRLY NKKNEWEKMQ  180
MQQQLVGAKE ATKQESSDMV ITSHSNNNNN SQQSHSWGEA RTPESEIVDH DDPSSFPAAF  240
QSPAAQEMLA TMMVPKKEAA DDAGAGAGRN DLFVDLSYDD IQSMYSGLDM MPPGDDLLYS  300
TLFASPRVRG TNQAGAGVGG MPGPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-10851782174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity (PubMed:16924117, PubMed:20632034). Transcription activator involved in response to abiotic stresses. Plays a positive role during dehydration and salt stress. Binds specifically to the 5'-CATGTG-3' motif found in promoters of stress-responsive genes (PubMed:16924117). {ECO:0000269|PubMed:16924117, ECO:0000269|PubMed:20632034}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g04150.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stresss, salt stress and cold stress (PubMed:16924117, PubMed:20632034). Induced by abscisic acid (ABA) (PubMed:16924117). Induced by methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:16924117, ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3947021e-157DQ394702.1 Oryza sativa (japonica cultivar-group) stress-induced transcription factor NAC1 (snac1) mRNA, complete cds.
GenBankKM5761351e-157KM576135.1 Oryza nivara stress-induced transcription factor NAC1 (SNAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563852.10.0NAC domain-containing protein 2
SwissprotQ75HE51e-154NAC2_ORYSJ; NAC domain-containing protein 2
TrEMBLI1GLQ00.0I1GLQ0_BRADI; Uncharacterized protein
STRINGBRADI1G04150.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-77NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  3. Chen Q,Wang Q,Xiong L,Lou Z
    A structural view of the conserved domain of rice stress-responsive NAC1.
    Protein Cell, 2011. 2(1): p. 55-63
    [PMID:21337010]