PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g03710.2.p
Common NameBRADI_1g03710, LOC100837426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Dof
Protein Properties Length: 462aa    MW: 46386.4 Da    PI: 9.2729
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g03710.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-38131190362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       e+ lkcprC+s+ntkfCy+nnysl+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nk+ss
  Bradi1g03710.2.p 131 EAGLKCPRCESSNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKRSS 190
                       6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819954.97E-5735No hitNo description
SuperFamilySSF819954.97E-56495No hitNo description
ProDomPD0074785.0E-35114188IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32133188IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.544134188IPR003851Zinc finger, Dof-type
PROSITE patternPS013610136172IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MVFSSVPGYL DPPNWNNNNQ PQQQQVQVQQ QQQQQLSHGH GGLLFPSAVG GGGGGVEAHH  60
HHHHQHQQQQ QQQQQQQMPA ALMAPPRAPD GSSGSMGGLG SGGGGGGGGS AVVKAGSMTD  120
RARMAKIPAP EAGLKCPRCE SSNTKFCYFN NYSLTQPRHF CKACRRYWTR GGALRNVPVG  180
GGCRRNKRSS KSSKSSSSSS AAACGVAAGV NTSSSSSATT SSATTGSGIM PALGQMPFFA  240
ASLVSGSGGG EGQYGVGGGG GLLAGVSRSL GFPGGLMGPM GSQQLDSAVE NYHHQLGGGM  300
GGSMEQWRLP PPQMQMQQFP FFGGGRGAGP DAMSGMQQLQ QQMQAGISNY PFEPDAGDGS  360
GEGFAAGQMM GGGGGGGKQV VPGSAGLITQ LASVKMEDNP PTAMAREFLG LPAAGSLQFW  420
AGGSGGNNGV SGGGAGAPGG GSGGWVDRLA GFNSSSSGNI L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g03710.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0685421e-71AK068542.1 Oryza sativa Japonica Group cDNA clone:J013155H18, full insert sequence.
GenBankAP0043031e-71AP004303.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0407H12.
GenBankAP0149631e-71AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559235.20.0dof zinc finger protein DOF5.1 isoform X1
TrEMBLA0A0Q3KMT30.0A0A0Q3KMT3_BRADI; Uncharacterized protein
STRINGBRADI1G03710.11e-177(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-43DNA binding with one finger 2.4