PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g02760.1.p
Common NameBRADI_1g02760, LOC100835193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 963aa    MW: 105093 Da    PI: 5.3586
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g02760.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.64.7e-40155232178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC adls ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Bradi1g02760.1.p 155 ACQVEGCCADLSAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNRRRRKTRP 232
                       5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-33148217IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.308153230IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-37154234IPR004333Transcription factor, SBP-box
PfamPF031108.0E-29156229IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.18E-8723847IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.4E-7744849IPR020683Ankyrin repeat-containing domain
CDDcd002041.25E-8746846No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 963 aa     Download sequence    Send to blast
MEAAGVGSQS RRLYGGGLGE PAQDMRGKRL FGWDLNDWSW DSERFVATPA PAAEKANGLS  60
LNSSPSSSEE ADVEVARSGN VRGDSDKRKR VVVIDDDGDD QKDEDPVDNN GRVLSLRIGG  120
DTTVAGGAVE GGAVNEEDRN GKKIRVQGGS SSGPACQVEG CCADLSAAKD YHRRHKVCEM  180
HAKANTAVVG NTVQRFCQQC SRFHLLQEFD EGKRSCRRRL AGHNRRRRKT RPEIAVGGTP  240
IEDKVGSYLV LSLLGICANL NSENAEHLQG QELLSNLWRN LGTVAKSLDP KELCKLLETC  300
QSMQNGSNTG TSEAANALVN SAAVEAAGPS NSKAPFTNGG QREQTSSAVI PLQSNATVVA  360
TPETPACRIR NFDLNDTCND MEGFEDGSNC PSVQQDSTQS PPQTSGNSDS TSAQSLSSSN  420
GDAQCRTDKI VFKLFDKVPS DLPPILRSQI LGWLSSSPTD IESYIRPGCI ILTVYLRLVD  480
SAWRELSENM SLYLDKLLSS STDNFWASSL VFVMVRHQIV FMHNGQVMLD RPLAPNSHHY  540
CKVLCVSPVA APSSATVNFR VEGFNLVSAS SRLICSFEGR CIFQEDTAIV DDAAEHEDIE  600
CLNICCSLPG SRGRGFIEVE DSGFSNGFFP FIVAEQDVCS EVCELESIFK SSSHEQADND  660
NARSQALEFL NELGWLLHRA NIISKHDKVE LPLAAFNLLR FRNLGIFAME REWCAVTKVL  720
LDLLFDGFVD VGLQSPKEVV LSENLLHTAV RGKSVRMVRF LLRYKPSKDQ KEIAESYLFR  780
PDARGPSTFT PLHIAAATSD AEDVLDALTS DPGLVGLNAW KNARDETGFT PEDYARQRGN  840
DAYMDLVQKK IDKNLGEGHV VLGVPSSMCP VLTDGAKPGD ISLEICKSMP MAPQPVSRCN  900
ICSRQARMYP SSFANTFLYR PAMFTVMGVA VICVCVGILL HTLPKVYAAP NFRWELLERG  960
PM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30149229484squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBradi1g02760.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478800.0KF447880.1 Triticum aestivum squamosa promoter-binding-like protein 6 (SPL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563064.10.0squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLI1GL800.0I1GL80_BRADI; Uncharacterized protein
STRINGBRADI1G02760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]