PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00186.3
Common NameAMTR_s00186p00018500, LOC18432892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 599aa    MW: 66131.4 Da    PI: 4.825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00186.3genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS442.52.9e-1352305973373
                                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                                             + L+ cA+a+s+g+l  a++++++l++++s +gdp qR+aay++e+Laar+a+s+++lykal+++e +   
  evm_27.model.AmTr_v1.0_scaffold00186.3 230 QILFGCATAISEGNLGGATTMVNELRQMVSVQGDPPQRIAAYMVEGLAARMASSGQGLYKALRCKEPP--- 297
                                             789****************************************************************9... PP

                                    GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRi 144
                                             s ++l+a+++++ev+P++kf++++aN +I ea++ eervHiiDfdi+qG Q+++L+qaLasRp+  p+l +
  evm_27.model.AmTr_v1.0_scaffold00186.3 298 SLDRLSAMQILFEVCPCFKFGFVAANGTITEAIKDEERVHIIDFDINQGSQYITLIQALASRPGRRPHLCL 368
                                             9********************************************************************** PP

                                    GRAS 145 Tgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrl 213
                                             Tgv++pes+  s   l  +g+rL+k+Ae+lg+pfef++ va++++d+++++L+++p+Eal+Vn+++qlh++
  evm_27.model.AmTr_v1.0_scaffold00186.3 369 TGVDDPESVqrSVGGLMIIGQRLEKLAEALGLPFEFRA-VASKTKDVRPSMLACRPDEALIVNFAFQLHHM 438
                                             *******99889999***********************.7******************************* PP

                                    GRAS 214 ldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                                             +desvs+ +erd++L++v++l Pk+v++veq++++n+++Fl+rf+ea eyy a+f+sl+ +l+res +r++
  evm_27.model.AmTr_v1.0_scaffold00186.3 439 PDESVSTVNERDRLLRMVRGLGPKLVTFVEQDVNTNTSPFLARFAEAYEYYLAVFESLDLTLARESTDRMN 509
                                             *********************************************************************** PP

                                    GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                                             vEr++l+r+ivn+vacega+r+er et++kWr r+++aGF+p pl++++ + + +llr + ++ y+v+ee 
  evm_27.model.AmTr_v1.0_scaffold00186.3 510 VERHCLARDIVNIVACEGADRIERYETAGKWRVRMTMAGFSPSPLGSQVKSAIGSLLRSYCNR-YTVKEEA 579
                                             *************************************************************77.******* PP

                                    GRAS 356 gslvlgWkdrpLvsvSaW 373
                                             g+l++gW+d++Lv++SaW
  evm_27.model.AmTr_v1.0_scaffold00186.3 580 GALYFGWEDKTLVTASAW 597
                                             ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.278202579IPR005202Transcription factor GRAS
PfamPF035141.0E-132230597IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MSLLRSTDPS STLYGDPNLY ALQSSTRAQG LPTRSFSLDR INLKYLPDFY GEVHNQLPFS  60
DSPLEEFISQ QVDFFPPTPT GSSPYHLISS LGPSANSQES CNMASIAQSH TSSLYDSSHH  120
GYAYESMDEH GRTMYDDAEE MRRKLQELEM ELLDDSDECV YDGHDMPIDM IESLLPNSPK  180
EPSDSNLTST STTTTTTSNS TSSTSTNRDS PTSNIISPCL SSTTSLTPKQ ILFGCATAIS  240
EGNLGGATTM VNELRQMVSV QGDPPQRIAA YMVEGLAARM ASSGQGLYKA LRCKEPPSLD  300
RLSAMQILFE VCPCFKFGFV AANGTITEAI KDEERVHIID FDINQGSQYI TLIQALASRP  360
GRRPHLCLTG VDDPESVQRS VGGLMIIGQR LEKLAEALGL PFEFRAVASK TKDVRPSMLA  420
CRPDEALIVN FAFQLHHMPD ESVSTVNERD RLLRMVRGLG PKLVTFVEQD VNTNTSPFLA  480
RFAEAYEYYL AVFESLDLTL ARESTDRMNV ERHCLARDIV NIVACEGADR IERYETAGKW  540
RVRMTMAGFS PSPLGSQVKS AIGSLLRSYC NRYTVKEEAG ALYFGWEDKT LVTASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6423559726378Protein SCARECROW
5b3h_A3e-6423559725377Protein SCARECROW
5b3h_D3e-6423559725377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843049.10.0scarecrow-like protein 1
RefseqXP_011622871.10.0scarecrow-like protein 1
RefseqXP_011622872.10.0scarecrow-like protein 1
RefseqXP_020522081.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLW1PAN10.0W1PAN1_AMBTC; Uncharacterized protein
STRINGERN047240.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP82621116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]