PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00184.20
Common NameAMTR_s00184p00044240, LOC18440173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 225aa    MW: 24213.6 Da    PI: 5.2478
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00184.20genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.52.8e-3551051101
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +C aCk+lrrkC+++Cv+ap fpa++p kfa +h +FGasn++k+l++lp+  r da+ sl+yeAe  +r
  evm_27.model.AmTr_v1.0_scaffold00184.20   5 PCGACKHLRRKCVRECVFAPFFPADNPDKFASIHTVFGASNLTKILSELPRVCRGDAIVSLIYEAESLIR 74 
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelallkeel 101
                                              dP +G + +i++lq  leql+++++++++el
  evm_27.model.AmTr_v1.0_scaffold00184.20  75 DPTKGPLHHIQSLQMGLEQLQEDIKVAQQEL 105
                                              **************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.644105IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-345102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MVTGPCGACK HLRRKCVREC VFAPFFPADN PDKFASIHTV FGASNLTKIL SELPRVCRGD  60
AIVSLIYEAE SLIRDPTKGP LHHIQSLQMG LEQLQEDIKV AQQELATLIS GESSSSNDPP  120
NPAPSLADGR TSDPPMMPPS SVAPPLMPTA PVTDRFLMQP VRQQVASDAV QYEFSSPSAF  180
FEASWNRLMS LTLEDAQRMG VHYIGGQDVT PATGTGMAGT SSLW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-33411210118LOB family transfactor Ramosa2.1
5ly0_B4e-33411210118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006850389.11e-166protein LATERAL ORGAN BOUNDARIES
TrEMBLW1PX401e-165W1PX40_AMBTC; Uncharacterized protein
STRINGERN119701e-166(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-36ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]