PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00184.19
Common NameAMTR_s00184p00043710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 151aa    MW: 15831.3 Da    PI: 7.3732
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00184.19genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260927.2e-294100197
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +CaaCk++ rkC++dC+lap+fp   +++f  vh +FG +nv +ll+++p+  r da+++l++eAea ++
  evm_27.model.AmTr_v1.0_scaffold00184.19   4 RCAACKYHHRKCPPDCILAPHFPIGTTERFLTVHSVFGSANVARLLAEVPPPLRGDAITTLLFEAEALLN 73 
                                              6********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelall 97 
                                              +  +G ++ i +lq +l++l++++ ++
  evm_27.model.AmTr_v1.0_scaffold00184.19  74 NGTKGPIAYIESLQMELRSLQTQIIAA 100
                                              *********************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.933104IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-29498IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MACRCAACKY HHRKCPPDCI LAPHFPIGTT ERFLTVHSVF GSANVARLLA EVPPPLRGDA  60
ITTLLFEAEA LLNNGTKGPI AYIESLQMEL RSLQTQIIAA NLELNMLRSR ATPPSVAPAC  120
STPPPSPGDS SSVIEGSGGM ELNGKPVGSP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-25510412111LOB family transfactor Ramosa2.1
5ly0_B2e-25510412111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1PVW11e-105W1PVW1_AMBTC; Uncharacterized protein
STRINGERN119691e-105(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-25LBD family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]