PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00176.19
Common NameAMTR_s00176p00044310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family M-type_MADS
Protein Properties Length: 356aa    MW: 39804.9 Da    PI: 5.3784
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00176.19genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.31.9e-131247742
                                             HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                                   SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                             + ++  + kRrng+ KK +ELSvLC++++++i fs 
  evm_27.model.AmTr_v1.0_scaffold00176.19 12 IHNSSNYVKRRNGLQKKLHELSVLCGIDACIISFSD 47
                                             567778***************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-4259IPR002100Transcription factor, MADS-box
PROSITE profilePS5006611.3531147IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-121394IPR002100Transcription factor, MADS-box
PfamPF003197.2E-111748IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MPTKRKAKDI QIHNSSNYVK RRNGLQKKLH ELSVLCGIDA CIISFSDASS SCVPDISPQD  60
TNYCLSLCER YLGLDKSERE KKLQDCSHFL SEKIQSLKQQ IDKKREENME AKLGAMVYGL  120
SGHHRIDELS IDDLQKLSGH IDVFLHKITE RDQFLEMGKH SVTEEILKVE NGGKLSANSQ  180
EIASDFAAAF SATPELGNGI KFAPKHEAGL GQFIDNFPGT PCLDTFPATL GVSPATFPAI  240
SGDFQADLGD LLARYGLYLA PTREGFPCTW QVSVLPYQQM SQHVVEGRWG PQLPNQHLPD  300
LFDMEGDLNP HQQVTQLPCN LPHQQYWDPE FQQVADPQPM NVERWVQDWS SPLGN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020526223.10.0agamous-like MADS-box protein AGL86
TrEMBLW1PU690.0W1PU69_AMBTC; Uncharacterized protein
STRINGERN113790.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.17e-20AGAMOUS-like 38
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]