PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00169.24
Common NameAMTR_s00169p00042500, LOC18438300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 300aa    MW: 33350.6 Da    PI: 8.239
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00169.24genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.99.3e-3511101191
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +CaaCk+lrrkC+++C++apyfp ++p++fa vhk+FGasnv+kll+++++ +re+a++ l++eA+ r++
  evm_27.model.AmTr_v1.0_scaffold00169.24  11 PCAACKFLRRKCTTECAFAPYFPPDHPERFADVHKVFGASNVSKLLNNISPPNREAAVTGLFFEARKRIQ 80 
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlk 91 
                                              dPv+G++++i++l  +l++l 
  evm_27.model.AmTr_v1.0_scaffold00169.24  81 DPVHGCTAHINELYGELNELY 101
                                              *************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.75410111IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3411101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMPSNNSNNS PCAACKFLRR KCTTECAFAP YFPPDHPERF ADVHKVFGAS NVSKLLNNIS  60
PPNREAAVTG LFFEARKRIQ DPVHGCTAHI NELYGELNEL YDLIKNAMNE LATYSPPYPH  120
PQLHHYLEMP ALPPSSKQQQ LPTAFAPPQQ LSAVQQYQQL SANAVQPREQ QPSEHRTLPL  180
QRKISSCHHH HYQEMMHAAS PSASQQLQQL SASASAAGAA QQHMQFSAAR PVKTEGQLHC  240
TKQPMMMPLP PPQQQRQQVV TGYEAELRSR EKAFVEAFKA GRDGCRSYLH GDGGEPHSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-3631153115LOB family transfactor Ramosa2.1
5ly0_B6e-3631153115LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848549.10.0LOB domain-containing protein 36
TrEMBLW1PSA10.0W1PSA1_AMBTC; Uncharacterized protein
STRINGERN101300.0(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-40ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]