PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00166.29
Common NameAMTR_s00166p00053380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 408aa    MW: 46156.1 Da    PI: 6.1017
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00166.29genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS277.54e-85113811374
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                              l++lLl+  e ++++++ +a+ lL      +sp g+p+qRl+ yf+eAL + l r  +++ ++ p+s+++
  evm_27.model.AmTr_v1.0_scaffold00166.29  11 LIHLLLSSTEKIENKQFDRAKGLLMVCDFKSSPVGNPVQRLVLYFAEALWEILER-ETGVRSQNPTSTQE 79 
                                              689***************************************************9.67777777666666 PP

                                     GRAS  71 eknsseelaalkl....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp 136
                                              + +++++l+ ++     f++v P+ k+ ++ta qa+l+a+++++r+H iD+++  G++W  L+q+L++R 
  evm_27.model.AmTr_v1.0_scaffold00166.29  80 NGDEERVLMGFHPailvFYQVVPFGKILQFTASQAMLDAMASSTRIHFIDLEVRTGMHWTMLMQSLSARL 149
                                              55555555444324455***************************************************** PP

                                     GRAS 137 egpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVn 205
                                              + p   l+iT vg+    s+e++e+ g+rL  f e+l++pf fn++v++++ +   e+L ++ gE++aV 
  evm_27.model.AmTr_v1.0_scaffold00166.29 150 DHPVeLLKITMVGN----SRERMEKAGNRLLGFSETLKLPFVFNLVVVSDMGEEIRERLPMEDGESVAVY 215
                                              6555499*******....9******************************999999*************** PP

                                     GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                                                l l ++l +++ le+    ++k++ sl P+++v++e e +hns+sF++rf+e l y++a fdsl+a +
  evm_27.model.AmTr_v1.0_scaffold00166.29 216 APLVLSSMLVKPHYLEN----LVKVISSLCPDIMVITEVEGKHNSPSFVKRFTEVLFYHAAYFDSLDAFF 281
                                              *********99999999....************************************************* PP

                                     GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                                               +++ +r + Er ++g +i+++v   g+er  rh  +  Wr  l++  F++v+ls++a  qa+l++++++
  evm_27.model.AmTr_v1.0_scaffold00166.29 282 DSDDANRLVTERLYMGTNIRSMVGRDGEERSIRHVGVDVWRLFLTRLLFEEVELSQDALYQASLIVKQHG 351
                                              ********************************************************************** PP

                                     GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                d  ++e + + l+ gWk  pL+s+SaWr
  evm_27.model.AmTr_v1.0_scaffold00166.29 352 hADSCTLELNGKPLTVGWKATPLYSASAWR 381
                                              9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.2571360IPR005202Transcription factor GRAS
PfamPF035141.4E-8211381IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSNEDIENIE LIHLLLSSTE KIENKQFDRA KGLLMVCDFK SSPVGNPVQR LVLYFAEALW  60
EILERETGVR SQNPTSTQEN GDEERVLMGF HPAILVFYQV VPFGKILQFT ASQAMLDAMA  120
SSTRIHFIDL EVRTGMHWTM LMQSLSARLD HPVELLKITM VGNSRERMEK AGNRLLGFSE  180
TLKLPFVFNL VVVSDMGEEI RERLPMEDGE SVAVYAPLVL SSMLVKPHYL ENLVKVISSL  240
CPDIMVITEV EGKHNSPSFV KRFTEVLFYH AAYFDSLDAF FDSDDANRLV TERLYMGTNI  300
RSMVGRDGEE RSIRHVGVDV WRLFLTRLLF EEVELSQDAL YQASLIVKQH GHADSCTLEL  360
NGKPLTVGWK ATPLYSASAW RCHRKGSSVL SLSLSRTLGK LTRNVTY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-334438136375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848950.20.0PREDICTED: DELLA protein GAI1
TrEMBLW1PS420.0W1PS42_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.15e-48RGA-like 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]