PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00166.25
Common NameAMTR_s00166p00048460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 501aa    MW: 56817.4 Da    PI: 5.4087
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00166.25genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.51.4e-901284971373
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                              l++lLl+ Ae ++++++ +a++lL      +sp g+p+qRl+ yf++AL + l r  ++ +k+ +p++t+
  evm_27.model.AmTr_v1.0_scaffold00166.25 128 LIHLLLSSAEKIENKHFDRAKSLLMVCDFKSSPIGSPIQRLVLYFANALWEILER--KTGAKSQNPTTTQ 195
                                              689****************************************************..3333344444444 PP

                                     GRAS  71 ekn.....sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasR 135
                                              e++           a+ +f +v P++k+ ++ta qaIl+a+ +++r+H iD+++  G+QW  L+q+L+ R
  evm_27.model.AmTr_v1.0_scaffold00166.25 196 ETEdderiLMGFHPATMAFCKVVPFMKVLQFTAIQAILDAMGSSTRIHLIDLEVRTGMQWTVLMQSLSGR 265
                                              344112322222234455**************************************************** PP

                                     GRAS 136 pegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaV 204
                                               + p   l+iT vg+    s+  +ee g++L +fA++l++pf fn++v++++ +   e+L ++ gE +aV
  evm_27.model.AmTr_v1.0_scaffold00166.25 266 LDHPVeLLKITMVGN----SRAWMEEAGNQLLSFAQTLKLPFVFNLVVVSDMGEEMREKLPMEDGEWVAV 331
                                              96555499*******....9************************************************** PP

                                     GRAS 205 nlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                                                 l l ++l ++++le+    ++++v+sl ++++v++e e +hns+sF++rf+e l yysa fdsl+a 
  evm_27.model.AmTr_v1.0_scaffold00166.25 332 YAPLVLRSMLVKPHCLEN----LVEVVRSLPSNIMVITEVEGKHNSPSFVKRFIEVLFYYSAYFDSLDAF 397
                                              ******************....************************************************ PP

                                     GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                                              + +++ +r ++Er+++g++i+++v  eg+er+ rh  +  Wr+ l+   F++v+ls++a  qa+l+++++
  evm_27.model.AmTr_v1.0_scaffold00166.25 398 FDSNDVNRLVIERACMGKWIQSMVGREGEERKIRHVGVDVWRQFLKGLRFEEVELSQDALYQASLIVKNH 467
                                              ********************************************************************** PP

                                     GRAS 345 k.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                                                 d  ++e + ++l+ gWk+ pL svSaW
  evm_27.model.AmTr_v1.0_scaffold00166.25 468 RnADSCTLEMNGKALTVGWKGTPLHSVSAW 497
                                              *9999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.146102477IPR005202Transcription factor GRAS
PfamPF035144.8E-88128497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MRLETPEINE GGNGIGASSP PRNPLFSNYD NVQAEIPENE KEERYPISLT ALEILKSYSS  60
LTKRLCNSSE IKEVTQLENP TLRGRKLSTE EVIRIAGEQY LYNGENLSLQ FNPQLSNINN  120
EDMKNIELIH LLLSSAEKIE NKHFDRAKSL LMVCDFKSSP IGSPIQRLVL YFANALWEIL  180
ERKTGAKSQN PTTTQETEDD ERILMGFHPA TMAFCKVVPF MKVLQFTAIQ AILDAMGSST  240
RIHLIDLEVR TGMQWTVLMQ SLSGRLDHPV ELLKITMVGN SRAWMEEAGN QLLSFAQTLK  300
LPFVFNLVVV SDMGEEMREK LPMEDGEWVA VYAPLVLRSM LVKPHCLENL VEVVRSLPSN  360
IMVITEVEGK HNSPSFVKRF IEVLFYYSAY FDSLDAFFDS NDVNRLVIER ACMGKWIQSM  420
VGREGEERKI RHVGVDVWRQ FLKGLRFEEV ELSQDALYQA SLIVKNHRNA DSCTLEMNGK  480
ALTVGWKGTP LHSVSAWMCL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3616249737374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848946.20.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
TrEMBLW1PKJ00.0W1PKJ0_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-49RGA-like 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]