PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00166.23
Common NameAMTR_s00166p00046540, LOC18438696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 501aa    MW: 56536 Da    PI: 7.4513
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00166.23genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.12.5e-881284981374
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                              l++lLl+ Ae ++++++e+a++lL      +sp g+p+qRl+ +f  AL + l +  ++l ++ p+ +++
  evm_27.model.AmTr_v1.0_scaffold00166.23 128 LTHLLLSSAEKIENKQFERAKRLLMVCDFESSPVGNPVQRLVLHFGDALWEILEQ-ETGLKSKNPTLTQE 196
                                              579***********************************************99998.66666666665555 PP

                                     GRAS  71 eknsseelaalkl....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp 136
                                              + +++++l+ ++     f+++ P+lk+ +lta qaIl+a++ + r+H iD+++  G +W   +q+L+sR 
  evm_27.model.AmTr_v1.0_scaffold00166.23 197 TGEEKKVLTGFHPatwaFYQIVPFLKVLQLTASQAILDAMAFSARIHLIDLEVRTGRHWTMVMQSLSSRL 266
                                              55544444433323456***************************************************** PP

                                     GRAS 137 egpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVn 205
                                              + p   l++T vg+    s+e++e+tg+rL +fA++l++pf fn++v++++ +   e++ ++ gE++aV 
  evm_27.model.AmTr_v1.0_scaffold00166.23 267 GHPVqLLKLTMVGN----SRETMEKTGNRLLSFAQTLKLPFAFNLVVVSDMGEEIRERFPMEDGESVAVY 332
                                              7665489*******....9******************************999999*************** PP

                                     GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                                                l l ++l +++ le+    ++k++ sl+P+v+v++e e +hns+sF++rf+e l y+sa fdsl+a +
  evm_27.model.AmTr_v1.0_scaffold00166.23 333 APLVLSSVLVKPHYLEN----LVKVISSLRPDVMVITEVEGKHNSPSFVKRFTEVLFYHSAYFDSLDAFF 398
                                              *********99999999....************************************************* PP

                                     GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                                               +++ +r ++Er+++g  i+++v  eg er+  h  +e W+  l++ GF++v+ls++a  qa+ll++++ 
  evm_27.model.AmTr_v1.0_scaffold00166.23 399 DSDDANRLVIERVCMGTGIRSMVGREGGERKITHVGVEVWKLFLKRLGFEEVELSQDALYQASLLVKNHR 468
                                              ********************************************************************** PP

                                     GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                d  ++e + ++l+ gWk+ pL svSaWr
  evm_27.model.AmTr_v1.0_scaffold00166.23 469 hADSCTLEMNGKALTVGWKGTPLHSVSAWR 498
                                              9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.634102477IPR005202Transcription factor GRAS
PfamPF035148.5E-86128498IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MRFEKPEIEG GGIGIGASRL HRNPLFLSYD NVQPEIAENK KAQRYPTSLS ALDTLKSYSS  60
LTKRLRNTSE INQVTQLKNP TLRGRKLSTE EVIRIAGEQY LYNGEDLSLQ FNPQLSNVNN  120
EDIKNIELTH LLLSSAEKIE NKQFERAKRL LMVCDFESSP VGNPVQRLVL HFGDALWEIL  180
EQETGLKSKN PTLTQETGEE KKVLTGFHPA TWAFYQIVPF LKVLQLTASQ AILDAMAFSA  240
RIHLIDLEVR TGRHWTMVMQ SLSSRLGHPV QLLKLTMVGN SRETMEKTGN RLLSFAQTLK  300
LPFAFNLVVV SDMGEEIRER FPMEDGESVA VYAPLVLSSV LVKPHYLENL VKVISSLRPD  360
VMVITEVEGK HNSPSFVKRF TEVLFYHSAY FDSLDAFFDS DDANRLVIER VCMGTGIRSM  420
VGREGGERKI THVGVEVWKL FLKRLGFEEV ELSQDALYQA SLLVKNHRHA DSCTLEMNGK  480
ALTVGWKGTP LHSVSAWRCL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3516149836375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006848944.10.0PREDICTED: scarecrow-like protein 18
TrEMBLW1PTB00.0W1PTB0_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-42RGA-like 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]