PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00160.8
Common NameAMTR_s00160p00038440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 313aa    MW: 32393 Da    PI: 9.0329
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00160.8genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.4e-393090262
                                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                            +e+ +kcprCds ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk+k ss
  evm_27.model.AmTr_v1.0_scaffold00160.8 30 AEQPQKCPRCDSLNTKFCYYNNYSLSQPRYFCKTCRRYWTRGGTLRNVPVGGGCRKKKPSS 90
                                            67899****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-271887IPR003851Zinc finger, Dof-type
PfamPF027016.7E-333287IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7143488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MQQERERGGG ADMLGCSSRA LQDRRAKPQA EQPQKCPRCD SLNTKFCYYN NYSLSQPRYF  60
CKTCRRYWTR GGTLRNVPVG GGCRKKKPSS KRATEPLTAS PSMVHDPEPV SSPPAAPVDP  120
VASTAGSVSV YYGSDQVGFG GFSGERPSQQ LTALQSMSHA INLGDLGPLF AHRGPQLGGG  180
QGFQLPVFSM GPNGMDPWRI QQREPSGGFG TPQQAMSGSS FDEAAMGGGR GGRVGIAGSG  240
VPSLVVLKTE GASSGRAEWP AAPTEGLFEG AGAASNAASA GGGYWGGGSV SGGWPDLSGY  300
GPPHPPSSTS FL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0341704e-33BT034170.1 Zea mays full-length cDNA clone ZM_BFc0033A15 mRNA, complete cds.
GenBankBT0373004e-33BT037300.1 Zea mays full-length cDNA clone ZM_BFb0161N12 mRNA, complete cds.
GenBankEU9742934e-33EU974293.1 Zea mays clone 445231 hypothetical protein mRNA, complete cds.
GenBankJX4284514e-33JX428451.1 Zea mays subsp. mays clone pUT3045 DOF29 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020525965.10.0dof zinc finger protein DOF3.1
TrEMBLW1PUI70.0W1PUI7_AMBTC; Uncharacterized protein
STRINGERN109750.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-34TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]