PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00160.11
Common NameAMTR_s00160p00053540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 229aa    MW: 25286.2 Da    PI: 5.6585
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00160.11genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof97.59.3e-313287560
                                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                                              lkcprCds +tkf yynnys+ qPr++C++C r Wt+GG+lrnvPvG+++rk++k
  evm_27.model.AmTr_v1.0_scaffold00160.11 32 PLKCPRCDSFDTKFWYYNNYSILQPRHYCRTCCRSWTNGGTLRNVPVGSSSRKRNK 87
                                             689*************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088424.6893387IPR003851Zinc finger, Dof-type
PfamPF027013.1E-273387IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-183387IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEQEIGDAAH LLRSSSLFLQ DPEEKSSYKK VPLKCPRCDS FDTKFWYYNN YSILQPRHYC  60
RTCCRSWTNG GTLRNVPVGS SSRKRNKPAE MTMNTTSAQL ETILSQPAPT TYSIAPPAGF  120
GSSFYSFEQG NGYDGTSDQG MLPQQFMGSE SQSHAMNFVG QFGSGFAEQG LPQLGAGLDG  180
MMQYEPTSGW RGERMPAWFD EGVIEKGPSP DSGSLTMPLP VTHYFTYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW1PSF61e-170W1PSF6_AMBTC; Uncharacterized protein
STRINGERN109781e-171(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38000.18e-27DNA binding with one finger 4.7
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]