PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00154.48
Common NameAMTR_s00154p00072430, LOC18435777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 410aa    MW: 45066.9 Da    PI: 8.4369
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00154.48genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP95.69.9e-3049129383
                                      TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                                              g+kdrhsk++T +g+RdRRvRls+++a++++dLq++LGf ++sk ++WLl +a ++i+el+ +++++a++
  evm_27.model.AmTr_v1.0_scaffold00154.48  49 GGKDRHSKVSTIKGLRDRRVRLSVPTAIQLYDLQERLGFNQPSKVVDWLLAAARHEIDELPPLQFEQANF 118
                                              78*************************************************************6666644 PP

                                      TCP  73 ceaesssssas 83 
                                               ++ s +   +
  evm_27.model.AmTr_v1.0_scaffold00154.48 119 HNDPSPQLIFQ 129
                                              42222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.21650108IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-2750170IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MIRDSRLKAS VTKQEDGIDD GNKNKGSSSS KPWSGPRDPR IVRVSRTFGG KDRHSKVSTI  60
KGLRDRRVRL SVPTAIQLYD LQERLGFNQP SKVVDWLLAA ARHEIDELPP LQFEQANFHN  120
DPSPQLIFQE ITKPLASSNS ASDSLVGFKD TGACSLSLFS SNKNVTSSDA TIGGDQTNLQ  180
RTSTWNLDSL REKSSVMPRD KDLGKSSSSK TYDHEYQENI HTHGSHVLAY NPVPTPNQSS  240
FSSVLNNMMP GTSYYHWEHT NPALSNAGSH GYPSQAIETH NSNTVSLPPS LSLVSMLQPN  300
IRQISATPSQ LATYFGAPLD LASKQLSHPQ LLSMNSQHMN PNSLGPPVYA ISPTMRPFQV  360
NFANYHNPHQ RDYDNQSNTL AKETASSSND QLADSSSIGL RGSNEQHLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1855109155Putative transcription factor PCF6
5zkt_B4e-1855109155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00326DAPTransfer from AT3G02150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845879.10.0transcription factor TCP5
RefseqXP_011623969.10.0transcription factor TCP5
RefseqXP_020523844.10.0transcription factor TCP5
RefseqXP_020523845.10.0transcription factor TCP5
RefseqXP_020523846.10.0transcription factor TCP5
RefseqXP_020523847.10.0transcription factor TCP5
RefseqXP_020523848.10.0transcription factor TCP5
TrEMBLW1PIK20.0W1PIK2_AMBTC; Uncharacterized protein
STRINGERN075540.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]