PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00153.12
Common NameAMTR_s00153p00034160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 284aa    MW: 31905.2 Da    PI: 7.0044
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00153.12genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.41.5e-3525124198
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq..pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAear 68 
                                              aCa+C+++rrkC+++Cv+ap+fp ++   ++fa vhklFG+s vlk+lk+ p+e++ +am++++yeA+ r
  evm_27.model.AmTr_v1.0_scaffold00153.12  25 ACASCRYQRRKCTPECVMAPHFPPNKegDRQFAHVHKLFGVSSVLKILKECPDEKKGEAMRTIIYEADLR 94 
                                              7*********************98773459**************************************** PP

                                   DUF260  69 ardPvyGavgvilklqqqleqlkaelallk 98 
                                              ardP+ Ga+gv+l l  +++q+ka+l++l+
  evm_27.model.AmTr_v1.0_scaffold00153.12  95 ARDPILGAYGVVLGLYDKIAQAKAHLDSLN 124
                                              ************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.55624127IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3425124IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDWISSPSPS SSCSSLTTSS NQHHACASCR YQRRKCTPEC VMAPHFPPNK EGDRQFAHVH  60
KLFGVSSVLK ILKECPDEKK GEAMRTIIYE ADLRARDPIL GAYGVVLGLY DKIAQAKAHL  120
DSLNSILMQI RLHEQQAKHH HCGSLYGQHE IERRCCGSTQ PVGLERRPYE SCCGFTQPID  180
LRLNQHVDPL LNQPIDPQLP ATTYAPGSLW SSSEYSQWYH QHSRVFPDAA PLMSVEAQEK  240
KPAVAARVDE MEDKLQAPLV PSRGELSMEV RSLERADDMQ RFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-23181474121LOB family transfactor Ramosa2.1
5ly0_B4e-23181474121LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020524679.10.0LOB domain-containing protein 15
TrEMBLW1PP670.0W1PP67_AMBTC; Uncharacterized protein
STRINGERN089800.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-28LOB domain-containing protein 22
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]