PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00148.27
Common NameAMTR_s00148p00049970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GATA
Protein Properties Length: 278aa    MW: 28963.5 Da    PI: 10.6618
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00148.27genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.81.3e-17154187134
                                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                              C++C   kTp+WR gp g+ktLCnaCG++y++ +
  evm_27.model.AmTr_v1.0_scaffold00148.27 154 CTHCEIQKTPQWRTGPLGPKTLCNACGVRYKSGR 187
                                              *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.097148184IPR000679Zinc finger, GATA-type
SMARTSM004015.1E-15148198IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.13E-15150211No hitNo description
Gene3DG3DSA:3.30.50.102.3E-14152185IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.22E-12153200No hitNo description
PROSITE patternPS003440154179IPR000679Zinc finger, GATA-type
PfamPF003202.6E-15154187IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MPELEWLSIF VEDSFSPSPA NPLPLVPHHH QQDSSASNLD TSSSSSSSSS SSSAASTITT  60
AAAAAAILSA VPGRARTKRP RPPPFTARLP LLSPSSSVTT VTPSPASPDS VTHIVESESR  120
PLKKKPTTTP TMGPTPNTIG PSTAGPTSQL GRKCTHCEIQ KTPQWRTGPL GPKTLCNACG  180
VRYKSGRLFP EYRPAASPTF VASLHSNSHK KVLEMRVRIG NRASDGLGSR RPTGPEDGGM  240
GPAGLSRLAK RGCGDSSPRP NGAHGQGFLV HSGGQYY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17781KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006846789.20.0GATA transcription factor 2 isoform X1
RefseqXP_020524364.10.0GATA transcription factor 2 isoform X1
RefseqXP_020524365.10.0GATA transcription factor 2 isoform X1
RefseqXP_020524366.10.0GATA transcription factor 2 isoform X2
TrEMBLW1PMH80.0W1PMH8_AMBTC; Uncharacterized protein
STRINGPOPTR_0010s23010.12e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-37GATA family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]