PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00137.36
Common NameAMTR_s00137p00078020
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 417aa    MW: 45006.7 Da    PI: 6.5863
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00137.36genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              ++lL +cA a++++d++la+++L+ l+++aspdgd++qRl+a f++AL  r  +  + l +  p s+   
                                              799************************************************99944444432222222.. PP

                                     GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                       l +f +++P+++f++ +aN +Il+ +++    ++H++D+++ +++Q+p+L++a+++ + +p
                                              ........2346***********************98766899*********************988899 PP

                                     GRAS 140 pslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvlvakrledl.eleeLrvkpgEala 203
                                              pslR+T++++  +       ++++ee+g++L  fA   gv++ef vl   ++  + ++++   ++gE+l+
                                              *********9554499999999************************9888999985688899999***** PP

                                     GRAS 204 VnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                                              Vn++++l ++++e++ ++  r+++L+ +++++P+++vvv++++d  se++  r+ +a++y ++ fd+ ea
                                              ***********99999999.9************************************************* PP

                                     GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                                               ++r seer  +Er  +g +i+n+v  eg+ r+er e++++W  rl++aGF+ v l+e a+++++ +l++
                                              **************9.9***************************************************** PP

                                     GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                              ++  g+ v+ e+g lvl+Wk+++ v++ aW
  evm_27.model.AmTr_v1.0_scaffold00137.36 385 HA-AGWGVKREDGDLVLTWKGHNAVFAMAW 413
                                              **.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.37620395IPR005202Transcription factor GRAS
PfamPF035144.6E-7747413IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-394041581474Protein SHORT-ROOT
5b3h_B7e-404041527420Protein SHORT-ROOT
5b3h_E7e-404041527420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020518388.10.0scarecrow-like protein 32
SwissprotQ9SN221e-119SCL32_ARATH; Scarecrow-like protein 32
TrEMBLW1NDV60.0W1NDV6_AMBTC; Uncharacterized protein
STRINGERM939270.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.18e-65GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089