PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00137.36
Common NameAMTR_s00137p00078020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 417aa    MW: 45006.7 Da    PI: 6.5863
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00137.36genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS259.31.3e-79474132373
                                     GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse 71 
                                              ++lL +cA a++++d++la+++L+ l+++aspdgd++qRl+a f++AL  r  +  + l +  p s+   
  evm_27.model.AmTr_v1.0_scaffold00137.36  47 EQLLAHCAAALQANDATLAHQILWVLNNIASPDGDSNQRLTAAFLRALVMRAGNPAPALESLRPLSPV-- 114
                                              799************************************************99944444432222222.. PP

                                     GRAS  72 knsseelaalklfsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                       l +f +++P+++f++ +aN +Il+ +++    ++H++D+++ +++Q+p+L++a+++ + +p
  evm_27.model.AmTr_v1.0_scaffold00137.36 115 --------QLATFIDLTPWHRFGFAAANATILDVMARLsaPALHVLDIGVAHCMQYPTLIDAISCIRPSP 176
                                              ........2346***********************98766899*********************988899 PP

                                     GRAS 140 pslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvlvakrledl.eleeLrvkpgEala 203
                                              pslR+T++++  +       ++++ee+g++L  fA   gv++ef vl   ++  + ++++   ++gE+l+
  evm_27.model.AmTr_v1.0_scaffold00137.36 177 PSLRLTVIEPDPTWlacppLNTTYEELGQKLMAFALVRGVKLEFGVLKPGNMGLVdRVSTVGRNQGEMLV 246
                                              *********9554499999999************************9888999985688899999***** PP

                                     GRAS 204 VnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                                              Vn++++l ++++e++ ++  r+++L+ +++++P+++vvv++++d  se++  r+ +a++y ++ fd+ ea
  evm_27.model.AmTr_v1.0_scaffold00137.36 247 VNSQHSLRYVPEETAGSTI-RNDLLSKIREMEPDLFVVVDEDVDFVSEQLGSRIRSAFNYWWMWFDAGEA 315
                                              ***********99999999.9************************************************* PP

                                     GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                                               ++r seer  +Er  +g +i+n+v  eg+ r+er e++++W  rl++aGF+ v l+e a+++++ +l++
  evm_27.model.AmTr_v1.0_scaffold00137.36 316 AMGRRSEERGGLERL-VGGRIENLVVGEGRGRVERGERKGRWGGRLRRAGFEGVGLGEGAEAEVRGVLEE 384
                                              **************9.9***************************************************** PP

                                     GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                              ++  g+ v+ e+g lvl+Wk+++ v++ aW
  evm_27.model.AmTr_v1.0_scaffold00137.36 385 HA-AGWGVKREDGDLVLTWKGHNAVFAMAW 413
                                              **.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.37620395IPR005202Transcription factor GRAS
PfamPF035144.6E-7747413IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MMHHYAAAGG GAALSLTLAP KPPTPGCPLL SAPVSKGPGG ADAHCMEQLL AHCAAALQAN  60
DATLAHQILW VLNNIASPDG DSNQRLTAAF LRALVMRAGN PAPALESLRP LSPVQLATFI  120
DLTPWHRFGF AAANATILDV MARLSAPALH VLDIGVAHCM QYPTLIDAIS CIRPSPPSLR  180
LTVIEPDPTW LACPPLNTTY EELGQKLMAF ALVRGVKLEF GVLKPGNMGL VDRVSTVGRN  240
QGEMLVVNSQ HSLRYVPEET AGSTIRNDLL SKIREMEPDL FVVVDEDVDF VSEQLGSRIR  300
SAFNYWWMWF DAGEAAMGRR SEERGGLERL VGGRIENLVV GEGRGRVERG ERKGRWGGRL  360
RRAGFEGVGL GEGAEAEVRG VLEEHAAGWG VKREDGDLVL TWKGHNAVFA MAWVPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-14484136374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006826690.20.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-120SCL32_ARATH; Scarecrow-like protein 32
TrEMBLW1NDV60.0W1NDV6_AMBTC; Uncharacterized protein
STRINGSi029796m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.18e-65GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]