PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00122.72
Common NameAMTR_s00122p00135250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 475aa    MW: 53617.1 Da    PI: 6.3666
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00122.72genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.41.1e-991324381321
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppset 69 
                                              l++lL++cA  v+ g+ e a +l+++++ l   +    + ++a +f+ AL  rl++            ++
  evm_27.model.AmTr_v1.0_scaffold00122.72 132 LIHLLMSCAGSVERGEREIALKLVQEMRLLLCRNItGVIGKVAVFFVDALFWRLSG-----------HPS 190
                                              689***************************555553899*****************...........344 PP

                                     GRAS  70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                              ++ +s e+ + ++ f+e +P+lkf+h+t+NqaIlea++g+++vH+iDf++ +GlQWpaL+qaLa Rp+gp
  evm_27.model.AmTr_v1.0_scaffold00122.72 191 NRVDSGESEFLYHHFYEGCPYLKFAHFTCNQAILEAFDGCDEVHVIDFNLIHGLQWPALIQALALRPGGP 260
                                              4445778888999********************************************************* PP

                                     GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                                              p lR+Tg+g+p+++ +++++e+g rLa++A++++v+f f+ ++++rledl++++++v++ E++aVn+v+ 
  evm_27.model.AmTr_v1.0_scaffold00122.72 261 PFLRLTGIGPPSPDGRDTIREVGIRLAELARSVNVRFAFRGVATQRLEDLKPWMIHVRSTETVAVNSVFV 330
                                              *****************************************9999************************* PP

                                     GRAS 210 lhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                                              lhrll  + +++++++ vL+ v++l Pk+++vveqea+hn+  F++rf+eal+yysa+fds+e +    +
  evm_27.model.AmTr_v1.0_scaffold00122.72 331 LHRLLYTTPDQTQPIKPVLNWVRELGPKILTVVEQEASHNGLGFVDRFTEALHYYSAMFDSMEGS----N 396
                                              ***************************************************************99....7 PP

                                     GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                              ++++   + +l+rei+n+v+ceg+er+erhe l +Wr r+++
  evm_27.model.AmTr_v1.0_scaffold00122.72 397 RNNQAFAELYLEREIKNIVCCEGSERVERHEPLTRWRGRFDK 438
                                              8888888899*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.2E-322187IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011295.0E-222194No hitNo description
PROSITE profilePS5098553.333106471IPR005202Transcription factor GRAS
PfamPF035144.0E-97132438IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MDYPFKTFPS TPSPPSKPEI DGLLADAGYR IKASDLPHVA HRLEQLETQM INAQPTEMTH  60
LASETVHYNP SDLATWVESM LFELNPSEIP ATSGFAGESQ SPEIGFFAGN QNRGSFSGAA  120
ILTHEEDSGI RLIHLLMSCA GSVERGEREI ALKLVQEMRL LLCRNITGVI GKVAVFFVDA  180
LFWRLSGHPS NRVDSGESEF LYHHFYEGCP YLKFAHFTCN QAILEAFDGC DEVHVIDFNL  240
IHGLQWPALI QALALRPGGP PFLRLTGIGP PSPDGRDTIR EVGIRLAELA RSVNVRFAFR  300
GVATQRLEDL KPWMIHVRST ETVAVNSVFV LHRLLYTTPD QTQPIKPVLN WVRELGPKIL  360
TVVEQEASHN GLGFVDRFTE ALHYYSAMFD SMEGSNRNNQ AFAELYLERE IKNIVCCEGS  420
ERVERHEPLT RWRGRFDKQD SNRLDSVRMR LDRRVCCSLF FRKMDLGWRR GMDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4017243342315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829673.20.0PREDICTED: LOW QUALITY PROTEIN: DELLA protein RHT-1
TrEMBLW1NQJ90.0W1NQJ9_AMBTC; Uncharacterized protein
STRINGVIT_11s0016g04630.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-128GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]