PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00122.72
Common NameAMTR_s00122p00135250
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 475aa    MW: 53617.1 Da    PI: 6.3666
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00122.72genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppset 69 
                                              l++lL++cA  v+ g+ e a +l+++++ l   +    + ++a +f+ AL  rl++            ++
  evm_27.model.AmTr_v1.0_scaffold00122.72 132 LIHLLMSCAGSVERGEREIALKLVQEMRLLLCRNItGVIGKVAVFFVDALFWRLSG-----------HPS 190
                                              689***************************555553899*****************...........344 PP

                                     GRAS  70 seknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                              ++ +s e+ + ++ f+e +P+lkf+h+t+NqaIlea++g+++vH+iDf++ +GlQWpaL+qaLa Rp+gp
                                              4445778888999********************************************************* PP

                                     GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                                              p lR+Tg+g+p+++ +++++e+g rLa++A++++v+f f+ ++++rledl++++++v++ E++aVn+v+ 
                                              *****************************************9999************************* PP

                                     GRAS 210 lhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                                              lhrll  + +++++++ vL+ v++l Pk+++vveqea+hn+  F++rf+eal+yysa+fds+e +    +
                                              ***************************************************************99....7 PP

                                     GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                              ++++   + +l+rei+n+v+ceg+er+erhe l +Wr r+++
  evm_27.model.AmTr_v1.0_scaffold00122.72 397 RNNQAFAELYLEREIKNIVCCEGSERVERHEPLTRWRGRFDK 438
                                              8888888899*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.2E-322187IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011295.0E-222194No hitNo description
PROSITE profilePS5098553.333106471IPR005202Transcription factor GRAS
PfamPF035144.0E-97132438IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-4212542211310Protein SCARECROW
5b3h_D1e-4212542211310Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829673.30.0LOW QUALITY PROTEIN: DELLA protein RHT-1
TrEMBLW1NQJ90.0W1NQJ9_AMBTC; Uncharacterized protein
STRINGERM970890.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-128GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089