PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00122.65
Common NameAMTR_s00122p00127250, LOC18425032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 383aa    MW: 41823.6 Da    PI: 5.4274
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00122.65genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-32152207156
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                              k+r++W+p+LH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  evm_27.model.AmTr_v1.0_scaffold00122.65 152 KARRCWSPDLHRRFVSALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 207
                                              68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.434149209IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-29149210IPR009057Homeodomain-like
SuperFamilySSF466892.75E-17149210IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26152207IPR006447Myb domain, plants
PfamPF002496.7E-7154205IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEASRQQLAS CSELTRSSSK PVLEEFIPIK RSSSEGSETT NMTSDKANWM TSAQLWSDQS  60
FPSSQKPAFN GKQRNGGAFL PFSKDRESRK TLSDLALAST EKEEIESPKF TEHEASGANK  120
MKENYNQVQG GGGGGLEREE NKGSSGGQTQ RKARRCWSPD LHRRFVSALQ QLGGSQVATP  180
KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPTPQAVPT PAPQLVVLGG IWVPQPDFSN  240
PSPNVNPSNP SQTLYTTTPP TQPHHFCQPT MAQDHLYAPT HRTYCDQMAL AHMNPSHPNG  300
SVIEQRGGSE SIEEDGKSES GSAENEVRDA GPALSLSRMH GHRHGNRGHD GDDMDEDGDG  360
DDDDGDDGDE DDSTGSEITL KF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14152205154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14152205154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14152205154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14152205154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829666.10.0myb family transcription factor EFM
SwissprotQ9ZQ852e-63EFM_ARATH; Myb family transcription factor EFM
TrEMBLW1NMG10.0W1NMG1_AMBTC; Uncharacterized protein
STRINGERM970820.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-56G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]