PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00119.78
Common NameAMTR_s00119p00099150, LOC18425206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 516aa    MW: 55531 Da    PI: 6.5044
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00119.78genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22e-39117177262
                                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                              ++k l+cprC+s +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  evm_27.model.AmTr_v1.0_scaffold00119.78 117 PDKVLPCPRCNSLDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHSA 177
                                              78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30114174IPR003851Zinc finger, Dof-type
PfamPF027015.0E-32118175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901121175IPR003851Zinc finger, Dof-type
PROSITE patternPS013610123159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MLEVKDPAIK LFGKTIPLLE NNFLSDSIDK SDDIQATSDE KETCQENNEA SGDKAGANTE  60
DPASPNDLKE CKEEPQNSNH EINKATPNPK DSKPLSTEED QTEIEGGGSQ EKTLKKPDKV  120
LPCPRCNSLD TKFCYYNNYN VNQPRHFCKN CQRYWTAGGT MRNVPVGAGR RKNKHSASHY  180
RHIMMSENLA KPLIEPQETN HHKVISCGVP PHTRPLKTGG TVLKFGPDAP LCESMETVLN  240
LGEQAVPKRE KVSENGEELS CGSSTVTAPT SVERELQENM VEKGGLVGCC KGGVGAPHLQ  300
CFPGGASPWP YPWAPNWTGV AAMAATSPGG RCSSEVVYGG PEHGGGSSGP VQWTTHPAIV  360
APPPPFCGPT VPFPFVPGSY WGCVPTWAGG TWPIPWVNSS YGNGLSPSST SSGNNSPTLG  420
KHSRDAPSQG EEKPEKSLWV PKTLRIDDPD EAAKSSIWAT LGIKHDSLEP IRKGGIFKAF  480
QPKVEGKDRS SETVQVLQAN PAALSRSHTF QESST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829835.10.0cyclic dof factor 2
TrEMBLW1NNG20.0W1NNG2_AMBTC; Uncharacterized protein
STRINGERM972510.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-77cycling DOF factor 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]