PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00119.112
Common NameAMTR_s00119p00135380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family TCP
Protein Properties Length: 218aa    MW: 24334.5 Da    PI: 10.4424
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00119.112genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP103.34e-32109197394
                                       TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                                               g+kd+hsk++T++g+RdR vRl a++a++f+d+qd+LG+d++sk+ +WL+++akpai+el + + + + 
  evm_27.model.AmTr_v1.0_scaffold00119.112 109 GRKDQHSKVSTAKGPRDRCVRLAAHTAIQFYDVQDRLGYDRPSKAMDWLINKAKPAIDELKKRTHKRSA 177
                                               89************************************************************9555553 PP

                                       TCP  72 ec.eaesssssasnsssgkaaksa 94 
                                               +  +a+s++ +++    +++ +++
  evm_27.model.AmTr_v1.0_scaffold00119.112 178 SLlNANSKHCNSK----PAQDSET 197
                                               3332222222222....1111111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-29109190IPR005333Transcription factor, TCP
PROSITE profilePS5136929.541110168IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MLSFLALWCI SAVAIEAHLW GKRPKSQPEE TTSESPPFLS TPLSQTQHHY QTPWLSPFPN  60
NAQTYGAISL GNQPQNSSEN QRQRLSFQSI GGRGEIVKVE GGHIVRAIGR KDQHSKVSTA  120
KGPRDRCVRL AAHTAIQFYD VQDRLGYDRP SKAMDWLINK AKPAIDELKK RTHKRSASLL  180
NANSKHCNSK PAQDSETPLK QLQSSIKPKS NHFFTEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A8e-18115168154Putative transcription factor PCF6
5zkt_B8e-18115168154Putative transcription factor PCF6
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168172KKRTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623141.19e-85transcription factor PCF5, partial
TrEMBLW1NQ881e-161W1NQ88_AMBTC; Uncharacterized protein
STRINGERM972851e-162(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31070.13e-41TCP domain protein 10
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]