PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00111.49
Common NameAMTR_s00111p00077850, LOC18428230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 250aa    MW: 27969.5 Da    PI: 8.0136
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00111.49genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-19112166256
                                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                              rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00111.49 112 RKKLRLSKEQSAVLEESFKEHNTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTK 166
                                              678899***********************************************98 PP

2HD-ZIP_I/II1278.1e-41112200190
                              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray 70 
                                              +kk+rlskeq+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++
  evm_27.model.AmTr_v1.0_scaffold00111.49 112 RKKLRLSKEQSAVLEESFKEHNTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCC 181
                                              69******************************************************************** PP

                              HD-ZIP_I/II  71 dalkeenerLekeveeLree 90 
                                              ++l+een+rL+ke +eLr +
  evm_27.model.AmTr_v1.0_scaffold00111.49 182 ERLTEENRRLHKELQELR-A 200
                                              *****************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.1E-17186IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466896.84E-19103169IPR009057Homeodomain-like
PROSITE profilePS5007117.329108168IPR001356Homeobox domain
SMARTSM003897.0E-16110172IPR001356Homeobox domain
CDDcd000865.14E-16112169No hitNo description
Gene3DG3DSA:1.10.10.604.4E-18112166IPR009057Homeodomain-like
PfamPF000461.5E-16112166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
SMARTSM003409.7E-25168211IPR003106Leucine zipper, homeobox-associated
PfamPF021831.2E-10168202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MVEREDLGLS LALAINPRLD SPFHSNALVA WSEAYRSERS SETRSFLRGI DVNRMPSSPV  60
DCEEEAVVSS PNSALSSASA KRGERESIGE ENEGERASSR GISDEEDGDT GRKKLRLSKE  120
QSAVLEESFK EHNTLNPKQK HALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEFLKRC  180
CERLTEENRR LHKELQELRA LKLGPRPYAH VPPTTLTICP SCERLPCLPS PAPLRAHRPG  240
LDGAAHGCV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006837330.10.0homeobox-leucine zipper protein HAT4
SwissprotP466022e-83HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLW1NXY01e-180W1NXY0_AMBTC; Uncharacterized protein
STRINGERN001840.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-79homeobox protein 2
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  4. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]