PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00109.70
Common NameAMTR_s00109p00086600, LOC18426638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CPP
Protein Properties Length: 567aa    MW: 61366 Da    PI: 7.9243
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00109.70genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.61.2e-1372111242
                                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                                              + k+CnCk+skClk+YCeCfa+g++C+  C+C +C+N+ e+
  evm_27.model.AmTr_v1.0_scaffold00109.70  72 KPKQCNCKNSKCLKLYCECFASGVYCDG-CNCVNCCNNPEN 111
                                              5699************************.********9875 PP

2TCR51.32.3e-16156195140
                                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                              k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN e
  evm_27.model.AmTr_v1.0_scaffold00109.70 156 KHNKGCHCKKSGCLKKYCECFQANILCSDNCKCMDCKNYE 195
                                              589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.0E-1471111IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.83272196IPR005172CRC domain
PfamPF036381.4E-1074108IPR005172CRC domain
SMARTSM011143.7E-20156197IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12159194IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MDKRVMESGL PQPDFPVKKL ARQLDFTAFC STSAPVTDII SRPTLPLQKP ESPRAPPRPR  60
TPFDAKDCTP KKPKQCNCKN SKCLKLYCEC FASGVYCDGC NCVNCCNNPE NEATRHEAVE  120
ATLERNPNAF RPKIASSPNA PRDSREELGE LPMVGKHNKG CHCKKSGCLK KYCECFQANI  180
LCSDNCKCMD CKNYEGSEER RALFQVDQGM HMTYLQQAAN AAITGAIGSS GYASPPINKK  240
RKNQEIFFGP GPPVKDQGVH RLGPIPQTNH IKTTSATSSS VAPVPVFKVA PPAVTAPSKF  300
TFRSLLADVV QPEYVTEFCK LLTMVSVETA KAFAVDNATK EKEIERIKSD QPENPTNSAP  360
SQNPDNGPKP LDDRKPTDER SSTNQAVKTN GEDSSSSDAG EGQKGRPMSP STLALMCDEQ  420
DTLFSAAASP SGANPKRFPY SQGSTELYGD QEMMVLTEFR DCLRKLVTVG RMKEAQFSTY  480
ATKIETPASH QEPDGNGPVQ APEAAQRLGE PTIQATPLAR NSTHFASNSS HFSGNSVPAT  540
SSNPTLTTNV GDPVVNGENK AQASNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-297020610133Protein lin-54 homolog
5fd3_B1e-297020610133Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006833343.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-152TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLW1NPJ30.0W1NPJ3_AMBTC; Uncharacterized protein
STRINGERM986210.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-134Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]