PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00106.107
Common NameAMTR_s00106p00136770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GATA
Protein Properties Length: 261aa    MW: 28970.5 Da    PI: 6.3613
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00106.107genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.91e-16177211135
                                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                               C++C t kTp+WR gp g+ktLCnaCG++y++ +l
  evm_27.model.AmTr_v1.0_scaffold00106.107 177 CTHCLTEKTPQWRCGPMGPKTLCNACGVRYKSGRL 211
                                               *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.7E-794258IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.11171207IPR000679Zinc finger, GATA-type
SMARTSM004012.8E-16171221IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-13174208IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.61E-14174235No hitNo description
CDDcd002021.80E-13176223No hitNo description
PfamPF003201.9E-14177211IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEAPFLYGLP SPDFFHIDDL LDFSNDQFSG EQTVGNFEMV TSSSPSMAMA ESARNNSNGS  60
WEDGESCPTL TPEICVPSED LAELEWLSTF VEESFSLPSL PESSDPLAGK PNSRPEPSLP  120
SRARSKRSRI ASTWASRIMT VSSPSPDSEF PVSLKSVTGT KPSKRTSFSG EFSGRKCTHC  180
LTEKTPQWRC GPMGPKTLCN ACGVRYKSGR LVPEYRPAAS PTFVLTQHSN SHRKVMELRR  240
QKELREGEMF IHERQDFKVF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006838190.20.0PREDICTED: GATA transcription factor 4
SwissprotO826326e-67GATA9_ARATH; GATA transcription factor 9
TrEMBLW1NZI00.0W1NZI0_AMBTC; Uncharacterized protein
STRINGVIT_15s0021g02510.t012e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.12e-55GATA transcription factor 9
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]