PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00105.9
Common NameAMTR_s00105p00029600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MYB
Protein Properties Length: 555aa    MW: 61805.2 Da    PI: 10.0339
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00105.9genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.7e-093291946
                                            TTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                         Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqk 46
                                            +G+++Wk+Ia  ++ gRt  qc++rw++
  evm_27.model.AmTr_v1.0_scaffold00105.9  3 FGPRSWKKIAGFVP-GRTQVQCRERWLN 29
                                            8999**********.***********98 PP

2Myb_DNA-binding408.8e-133981347
                                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                         Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                             WT  Ed +l+ a++++G   W++Ia+++   Rt+ qc+ rw  +
  evm_27.model.AmTr_v1.0_scaffold00105.9 39 EWTDGEDSKLKAAIAEHGYC-WSKIASHVH-PRTDSQCRRRWKVL 81
                                            6*****************99.*********.9**********875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.793131IPR017930Myb domain
SMARTSM007179.6133IPR001005SANT/Myb domain
CDDcd001676.02E-6231No hitNo description
PfamPF002491.1E-7229IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-13336IPR009057Homeodomain-like
SuperFamilySSF466891.54E-231182IPR009057Homeodomain-like
PROSITE profilePS5129421.1973286IPR017930Myb domain
SMARTSM007177.0E-133684IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-163780IPR009057Homeodomain-like
CDDcd001673.86E-113982No hitNo description
PfamPF002492.5E-113980IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MLFGPRSWKK IAGFVPGRTQ VQCRERWLNS LDPSLKLEEW TDGEDSKLKA AIAEHGYCWS  60
KIASHVHPRT DSQCRRRWKV LFPEEVPVAQ KARKLQKAAL ISNFVGREKE RPAIGPDDFV  120
PVSEENSPDS LVPVSEENML LGASDGHVGT MNKTCTTPKL KKKRRQKGRA SDDLVPVSEE  180
NVLLDPSDGH VGNMNQTCTT PKLIKKKKGE NRASGDVAKR GVFKSRTKKN SLEDALITEG  240
GGSQSNLCDS GNASRKASSR KSLNKKKRLV EDRNLTTQEN FKSHKESKRR KGALSNEDTC  300
LNMIHEIPPL NSFHEKKQKD KQIKSVSLPV NSPTKKKQKK KPVKLGHVSI RENRGATKSS  360
MKPISLRKLK QAIREEAVTS IVSERSCVVE RAAFQVTDSS KERGRDNCDQ NQGPNAMDEN  420
TLVPLQHYGP LLNTRENVSD ANPHETAHIT EMACCPLVGC SSSEPITMKE SPELSLKEDK  480
MCEQCLNQRQ DADGSDVSLP QDTLLDKNEN SSLLATNLAL VSLAEREHAS PKKSRRASRK  540
NIDYSEMVKG KVWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A2e-134782195MYB3
3zqc_D2e-134782195MYB3
3zqc_G2e-134782195MYB3
3zqc_J2e-134782195MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159166LKKKRRQK
2160164KKKRR
3161166KKRRQK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011621134.10.0PREDICTED: uncharacterized protein LOC18428061
TrEMBLW1NXE90.0W1NXE9_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.24e-38myb domain protein 4r1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]