PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00095.150
Common NameAMTR_s00095p00172370, LOC18426251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family M-type_MADS
Protein Properties Length: 229aa    MW: 25602.2 Da    PI: 10.077
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00095.150genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.71.5e-131151343
                                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                              i n+s r+ +f kR+ g+lKK  ELS+LC++ +  +++++ 
  evm_27.model.AmTr_v1.0_scaffold00095.150 11 IANDSARKSSFKKRKRGLLKKIAELSTLCGVPAFAVVYGPG 51
                                              89***********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.488161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-18160IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-6323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-21395IPR002100Transcription factor, MADS-box
PfamPF003195.6E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARKKVTLAW IANDSARKSS FKKRKRGLLK KIAELSTLCG VPAFAVVYGP GDHTPDVWSS  60
DSKAQTVLHR FKSLPETDRN KKTMDHDGFL RQRIQKLRDQ IQRQRRENRE AAAASLLNEG  120
LAGKGIQSTA VDELNELSRL IERRSAAVRE RIAVLRSEEA MAKERISAVG QVMPEMDDHK  180
WFLDEMLGIG GGQLGDILGG QSAYFQDNSW ANMESAALYG DYYAMMRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLAWIANDSARKSSFKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006832972.11e-169agamous-like MADS-box protein AGL80
TrEMBLW1NT981e-168W1NT98_AMBTC; Uncharacterized protein
STRINGERM982501e-168(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-29AGAMOUS-like 80
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]