PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00088.132
Common NameAMTR_s00088p00161000, LOC18427652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 559aa    MW: 62194.6 Da    PI: 6.2018
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00088.132genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4571.2e-1391895582374
                                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                               +++L++cA+a+s++d+ +a++l+++l++++s +g+p+qRl ay++e+L ar+a+s+s +yk+l++++  
  evm_27.model.AmTr_v1.0_scaffold00088.132 189 RKALVACAKAISDNDMPMADWLITELRQMVSVSGEPIQRLGAYMVEGLVARIASSGSAIYKSLRCKQPL 257
                                               789*****************************************************************8 PP

                                      GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                   s+ l+++++++ev+P++kf++l aN aI ea++ge+rvHiiDf+i qG+QW++L+qaLa+Rp+gp
  evm_27.model.AmTr_v1.0_scaffold00088.132 258 ---ASDLLSYMHVLYEVCPYFKFGYLSANGAIAEALKGEDRVHIIDFQIAQGTQWVTLIQALAARPGGP 323
                                               ...99**************************************************************** PP

                                      GRAS 140 pslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnl 206
                                               p lRiTgv++p s   +   le +g+rLak+A+ ++vpfefn+ +a   +++e+ +L+v+p++alaVn+
  evm_27.model.AmTr_v1.0_scaffold00088.132 324 PYLRITGVDDPVSAyaRGCGLELVGQRLAKLAKLCNVPFEFNA-AAICGSQVEVGMLKVRPNDALAVNF 391
                                               ***********999889999***********************.899********************** PP

                                      GRAS 207 vlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                                                +qlh+++desvs+ ++rd++L+++ksl+Pkvv++veqe+++n+++Fl+rf+e l+yysa+f+s++++l
  evm_27.model.AmTr_v1.0_scaffold00088.132 392 PFQLHHMPDESVSTVNHRDRLLRMIKSLNPKVVTLVEQESNTNTAPFLHRFVEVLSYYSAVFESIDVTL 460
                                               ********************************************************************* PP

                                      GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                                               pr+s+eri+vE+++l+r+ivnv+aceg+er+erhe l+kW+ r+++aGF+p+pls+++++++k+ll+ +
  evm_27.model.AmTr_v1.0_scaffold00088.132 461 PRDSKERISVEQHCLARDIVNVIACEGQERVERHELLGKWKLRFMMAGFSPYPLSSSVNSTIKSLLEGY 529
                                               ********************************************************************* PP

                                      GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                                ++ yr+ee++g l+lgWk+r Lv+ +aWr
  evm_27.model.AmTr_v1.0_scaffold00088.132 530 CEN-YRLEEKDGVLYLGWKNRVLVASCAWR 558
                                               *55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.972162539IPR005202Transcription factor GRAS
PfamPF035144.0E-137189558IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MDSQFRSEHI SSRKNLQYFL STPRDPENHQ MVQSSMINGQ NQGRESYQPL DYLFSEGCQG  60
KINLSTQSSQ GPSYATLESS PQNLGHSLYS SPSTLSFSPN ESPLSQQDSQ TYPLELPHSP  120
EHFYGSPRSG SCITEEPNDF KNKLRELETA MLGPNSDGGD SFEASVQNQV SLEPDKWPQM  180
VDILRGGIRK ALVACAKAIS DNDMPMADWL ITELRQMVSV SGEPIQRLGA YMVEGLVARI  240
ASSGSAIYKS LRCKQPLASD LLSYMHVLYE VCPYFKFGYL SANGAIAEAL KGEDRVHIID  300
FQIAQGTQWV TLIQALAARP GGPPYLRITG VDDPVSAYAR GCGLELVGQR LAKLAKLCNV  360
PFEFNAAAIC GSQVEVGMLK VRPNDALAVN FPFQLHHMPD ESVSTVNHRD RLLRMIKSLN  420
PKVVTLVEQE SNTNTAPFLH RFVEVLSYYS AVFESIDVTL PRDSKERISV EQHCLARDIV  480
NVIACEGQER VERHELLGKW KLRFMMAGFS PYPLSSSVNS TIKSLLEGYC ENYRLEEKDG  540
VLYLGWKNRV LVASCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-661885584375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006836764.10.0scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLW1NVH50.0W1NVH5_AMBTC; Uncharacterized protein
STRINGERM996170.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  4. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]