PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00083.21
Common NameAMTR_s00083p00067130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 115aa    MW: 12461.9 Da    PI: 8.8114
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00083.21genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26023.31.7e-071316999
                                   DUF260 69 ardPvyGavgvilklqqqleqlkaelallke 99
                                             ++dPvyG+vg i+ lq+q+++l++el+++++
  evm_27.model.AmTr_v1.0_scaffold00083.21  1 MKDPVYGCVGAISVLQRQVHRLQKELDAANA 31
                                             58************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.4E-5230IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MKDPVYGCVG AISVLQRQVH RLQKELDAAN ADLIRFACAS PDMHNPILTP DQLLIRRIGN  60
SGSLSHPSLS HQNLTPHSLS HHQGSSDSFP NNGFPPTWSN TSPGGNTRRG ENRM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-1713879116LOB family transfactor Ramosa2.1
5ly0_B3e-1713879116LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020520762.13e-80LOB domain-containing protein 25
TrEMBLW1NY088e-79W1NY08_AMBTC; Uncharacterized protein
STRINGERN025171e-79(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-16LBD family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]