PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00080.30
Common NameAMTR_s00080p00087770, LOC18433082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family Dof
Protein Properties Length: 264aa    MW: 28630 Da    PI: 7.9442
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00080.30genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.81.5e-4050109261
                                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                              +e+alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGG+lrnvPvGgg+rknk+s
  evm_27.model.AmTr_v1.0_scaffold00080.30  50 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKACRRYWTKGGSLRNVPVGGGCRKNKRS 109
                                              7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2941108IPR003851Zinc finger, Dof-type
PfamPF027013.8E-3452108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.61854108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MALTSSLQAC MDPASAHHQG MGGQSLEDMT SSMPSSSSLM QQERRLKPQP EQALKCPRCD  60
STNTKFCYYN NYSLSQPRYF CKACRRYWTK GGSLRNVPVG GGCRKNKRST PKKQPDHQNP  120
PSSSSAPQIP SSLELSILGN PNPTSGILGN PSATTNPGFL SHLESLRSCF EVPNKALMLE  180
NSNQEVSQQN QYGVGNMGFY NFCSLNPKVE EGEELGFPFQ EMGGLQWQQQ VSGGDGSGMF  240
DAGGYWNGVG TWHHGASSVS PLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006843242.10.0dof zinc finger protein DOF5.3 isoform X1
RefseqXP_020522191.10.0dof zinc finger protein DOF5.3 isoform X1
TrEMBLW1P4V20.0W1P4V2_AMBTC; Uncharacterized protein
STRINGERN049170.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-38TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]