PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00079.30
Common NameAMTR_s00079p00088960, LOC18432113
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 283aa    MW: 30697.6 Da    PI: 6.9668
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00079.30genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260100.71.4e-314107199
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeA 65 
                                              +C++C+vlr++C+++C ++p++     p++q++++ +++k++G++ +++l++a p++ r+++++sl+yeA
  evm_27.model.AmTr_v1.0_scaffold00079.30   4 SCNGCRVLRKGCSENCSIRPCLqwiknPESQANATVFLAKFYGRAGLMNLINAGPDHLRPAIFRSLLYEA 73 
                                              6********************************************************************* PP

                                   DUF260  66 earardPvyGavgvilklqqqleqlkaelallke 99 
                                              + r+ +P+yG+vg+++++++ql+q+++e++l ++
  evm_27.model.AmTr_v1.0_scaffold00079.30  74 CGRIVNPIYGSVGLLWSGSWQLCQAAVEAVLKGA 107
                                              ****************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.9273109IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-254103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MRMSCNGCRV LRKGCSENCS IRPCLQWIKN PESQANATVF LAKFYGRAGL MNLINAGPDH  60
LRPAIFRSLL YEACGRIVNP IYGSVGLLWS GSWQLCQAAV EAVLKGAPIV QISTEAAANQ  120
GPAIAPLSSK PYDIRHVSKE ENTNTNSAAC ADLHKVKSRS RFKRSASKPK PKLEAEPVPE  180
PTDNELAQVC NLRWRRCYPG GFNGVDSDSS SQSEPTAEGD DSAFSAETVE VSLARRADSE  240
TDPDSRVEEI GLELTLGFEP APRTRVERHH SSEPVSDVTL GL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842288.10.0LOB domain-containing protein 40
SwissprotQ9M8868e-83LBD41_ARATH; LOB domain-containing protein 41
TrEMBLW1P7Q50.0W1P7Q5_AMBTC; Uncharacterized protein
STRINGERN039630.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4031699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-83LOB domain-containing protein 41
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]