PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00077.226
Common NameAMTR_s00077p00190160, LOC18432479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRAS
Protein Properties Length: 759aa    MW: 82271.7 Da    PI: 6.2611
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00077.226genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4071.8e-1243967512374
                                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsets 70 
                                                +lLl+cAeavs++ l +a+a+La++ el++p g++ qR+aayf eA++arl++ + ++y+ lp+  ++
  evm_27.model.AmTr_v1.0_scaffold00077.226 396 LTLLLQCAEAVSAERLDEASAMLAEIAELSTPFGSSAQRVAAYFSEAMSARLVSACLGVYSPLPACVQN 464
                                               579************************************************************888886 PP

                                      GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                                                   ++ ++a+++f+ +sP++kfsh+taNq+I ea+e+eervHiiD+di+qGlQWp L++ LasRp+gp
  evm_27.model.AmTr_v1.0_scaffold00077.226 465 ----QKIVSAFQVFNGISPFVKFSHFTANQMIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGP 529
                                               ....78999************************************************************ PP

                                      GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvl 208
                                               p++R+Tg+gs    s+e+le+tg+rLa+fAe+lg+pfe+   +a++  ++ +e+L ++++Ea+aV++ +
  evm_27.model.AmTr_v1.0_scaffold00077.226 530 PRVRVTGLGS----SEEALEATGRRLAEFAETLGLPFEWCG-LAEKAGNVGVERLGIRKREAVAVHCLH 593
                                               **********....9**************************.599***********************9 PP

                                      GRAS 209 qlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                                                 h+l+d ++s ++    +L l+++lsPkvv++veq+++h + sFl+rf+ea++yysalfdsl a+ ++
  evm_27.model.AmTr_v1.0_scaffold00077.226 594 --HSLYDVTASDAN----TLALIQRLSPKVVTMVEQDLSH-GDSFLARFVEAIHYYSALFDSLGASQAE 655
                                               ..999988888888....**********************.668*******************9999** PP

                                      GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                                               +s+er++vE++ll+rei+n++a  g +r  + + +e+Wre+l+++GFk+++l  +aa+qa lll +++s
  evm_27.model.AmTr_v1.0_scaffold00077.226 656 DSHERHVVEQQLLSREIKNLLAVGGPSRSGEIK-FENWREKLRQCGFKAMSLAGNAATQATLLLGMFPS 723
                                               ***************************888776.*********************************** PP

                                      GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                                               dgy++ e++g+l lgWkd  L+++SaWr
  evm_27.model.AmTr_v1.0_scaffold00077.226 724 DGYTLVEDKGTLKLGWKDLCLLTASAWR 751
                                               ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.73369731IPR005202Transcription factor GRAS
PfamPF035146.2E-122396751IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MAACVVVGSN GGRLGSGGSS SSGGSHSGSD GAAPLPREVV TAHYGGGEEE ARITMEGRMI  60
GSSNSRKRGA SEMDDGQQLH MSSGLVQHPR VFRRAADNDL DMAAQLHTYS SGNNRCSILL  120
HETQGAAPPP PPSFFSDTTA TTYYNHLQQQ PATITMPAVQ QQPPPLTLCG FSGLPLFTSS  180
STEKGRSSFD ATAALPQQQQ QASSSSSVVA MDEAETWIDG IIKDLVHTSP VPIPQLIQNV  240
REVIFPCNPQ LAALLEFRLR SLPESSPADK QQLPLGSGLK LRIEQQPGTG SIESFPTALP  300
WLSSSTSSSK EHQGMAETMM MNQQYVNWAL DERPPLPPTP PLLSLNQSSS NNTSPPKKSA  360
AQTEEESHHQ QKLRERERRK QQEQQAKRDS EGLHLLTLLL QCAEAVSAER LDEASAMLAE  420
IAELSTPFGS SAQRVAAYFS EAMSARLVSA CLGVYSPLPA CVQNQKIVSA FQVFNGISPF  480
VKFSHFTANQ MIQEAFEREE RVHIIDLDIM QGLQWPGLFH ILASRPGGPP RVRVTGLGSS  540
EEALEATGRR LAEFAETLGL PFEWCGLAEK AGNVGVERLG IRKREAVAVH CLHHSLYDVT  600
ASDANTLALI QRLSPKVVTM VEQDLSHGDS FLARFVEAIH YYSALFDSLG ASQAEDSHER  660
HVVEQQLLSR EIKNLLAVGG PSRSGEIKFE NWREKLRQCG FKAMSLAGNA ATQATLLLGM  720
FPSDGYTLVE DKGTLKLGWK DLCLLTASAW RPPSPINH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.03797543382Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor involved in asymmetric cell division. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842644.10.0protein SCARECROW
SwissprotQ9AVK40.0SCR_PEA; Protein SCARECROW
TrEMBLW1P9G40.0W1P9G4_AMBTC; Uncharacterized protein
STRINGERN043190.0(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]