PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00076.41
Common NameAMTR_s00076p00127530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 200aa    MW: 21808.3 Da    PI: 8.1605
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00076.41genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.4e-3912109198
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70 
                                              +Ca+Ck+lrr+C+kdC++ pyfpa++p+kfa vh++FGasnv+k+l+++p ++r da+ s+vyeA+ar++
  evm_27.model.AmTr_v1.0_scaffold00076.41  12 PCAGCKLLRRRCTKDCIFVPYFPATDPEKFAGVHRIFGASNVSKMLRDIPVNQRGDAVCSMVYEAHARLK 81 
                                              7********************************************************************* PP

                                   DUF260  71 dPvyGavgvilklqqqleqlkaelallk 98 
                                              dP+yG+v+ i +lq+q++ l+aela+++
  evm_27.model.AmTr_v1.0_scaffold00076.41  82 DPIYGCVAAIVSLQHQVSILQAELAMTN 109
                                              ************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.27311112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4012109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MKSCSRMKIK MPCAGCKLLR RRCTKDCIFV PYFPATDPEK FAGVHRIFGA SNVSKMLRDI  60
PVNQRGDAVC SMVYEAHARL KDPIYGCVAA IVSLQHQVSI LQAELAMTNA DNMSLKAQLS  120
DALSALSHAS PRAMDHVQGK MCTITQLSDA LTIFARASTR AAMDTEHANT YSFSTALDHG  180
YLEQPTSSLP HLLDCAELL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-401210511104LOB family transfactor Ramosa2.1
5ly0_B5e-401210511104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020522059.11e-147LOB domain-containing protein 4
SwissprotQ8LBW37e-47LBD12_ARATH; LOB domain-containing protein 12
TrEMBLW1PAS41e-146W1PAS4_AMBTC; Uncharacterized protein
STRINGERN046761e-147(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-48LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]