PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00073.16
Common NameAMTR_s00073p00061640, LOC18425270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CO-like
Protein Properties Length: 391aa    MW: 43444.5 Da    PI: 5.0016
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00073.16genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.46.8e-092264440
                                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                                             r C+ +++ +++++C  ++ +lC+ C  ++H+       H++v
  evm_27.model.AmTr_v1.0_scaffold00073.16 22 RPCDSCGKGRARWYCAADDAFLCHACDGTIHSAnsvarrHDRV 64
                                             78******99*********************657788888776 PP

2CCT68.32e-23338381144
                                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  evm_27.model.AmTr_v1.0_scaffold00073.16 338 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT 381
                                              9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.8E-81966IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4241966IPR000315B-box-type zinc finger
CDDcd000219.93E-92266No hitNo description
PfamPF006431.9E-62264IPR000315B-box-type zinc finger
PfamPF062035.0E-18338380IPR010402CCT domain
PROSITE profilePS5101716.083338380IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0010223Biological Processsecondary shoot formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MTSSAESRRA VVAAAAGAKT VRPCDSCGKG RARWYCAADD AFLCHACDGT IHSANSVARR  60
HDRVRLKTSS SHRCEFVLPS WQRGKARSMR PHPNMKNPID GAKPHANPLV VPQMQEESSP  120
DEVDEQLLYQ VPVFEPMAAD LRSSPARATP ADCKPTIDTP AEMAVAKFSA IPSLDMDLAD  180
FAADVESLLG QGLDEDAFGI EGLGLLDNYR EEEEGVASRV KVEEEEDEDG IFGCSHHPDV  240
AEVELSSETL EFNFDYDTPT TAGEDDEEKC RIVLEKSISL RLDYEAVISA WGRSPWTTGQ  300
RPEFNPDDCW PDPFTGNCVP EMSTYSEVGN ATASDGGREA RVSRYREKRR TRLFSKKIRY  360
EVRKLNAEKR PRMKGRFVKR TSFPPTPYPF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1348364RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829901.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6
TrEMBLW1NNG90.0W1NNG9_AMBTC; Uncharacterized protein
STRINGVIT_01s0011g03520.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.12e-77B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]